Conserved Protein Domain Family
sula

?
TIGR00623: sula 
cell division inhibitor SulA
All proteins in this family for which the functions are known are cell division inhibitors. In E. coli, SulA is one of the SOS regulated genes. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129710
View PSSM: TIGR00623
Aligned: 4 rows
Threshold Bit Score: 281.83
Threshold Setting Gi: 135049
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08846     2 YTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQAS 81  Escherichia coli
AAA27230   2 YTSGYANRSSSFPTTTHNAARTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQSRWQLWLTPQQKLSREWVQSS 81  Salmonella enterica...
P08848     2 FTSAHANRSPLTSASVRRPSHSVVEHSATGLISEIVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSKEWVQSS 81  Enterobacter aerogenes
P08845     3 TQSLYQPHFGHGSYTTRNVAKNTDIGKENGLISELVYNERQPAVAQ-LLLPLLLQLGKQSRWLLWLTPQQKLSKQWLQQS 81  Serratia marcescens
P08846    82 GLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLADDLTEEEHAELVDAANEGNAMGFIMRPVSASSHATRQLSGL 161 Escherichia coli
AAA27230  82 GLPLTKVMQISQLAPRHTLETMIRALATGNYSVVIGWMTEELTEEEHASLVEAAKVGNAVGFIMRPVRALALPRRQHSGL 161 Salmonella enterica...
P08848    82 GLPLSKVMQINQMSPCNTLESMIRALRTGNYNVVIGWLTDELTEQEHERLALAAEEGHPMGFIMRPVRNTSQPGRQLSGL 161 Enterobacter aerogenes
P08845    82 GLPVDKMVQLSQISPVNTVEAMEKALQTGNYSVVLGWLP-ELTEEDRLKLRRAAELGNAYGFIMRPQRDISPTHGHCSTL 160 Serratia marcescens
P08846   162 KIHSNLYH 169 Escherichia coli
AAA27230 162 KIHSNLYH 169 Salmonella enterica subsp. enterica serovar Typhimurium
P08848   162 KIHSNLYH 169 Enterobacter aerogenes
P08845   161 KIHSSLYH 168 Serratia marcescens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap