Conserved Protein Domain Family
ssl1

?
TIGR00622: ssl1 
transcription factor ssl1
All proteins in this family for which functions are known are components of the TFIIH complex which is involved in the initiaiton of transcription and nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129709
View PSSM: TIGR00622
Aligned: 3 rows
Threshold Bit Score: 183.213
Threshold Setting Gi: 17380326
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q04673   346 GYFCPNCHSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFAEVPTTEKFRSEDCFSCQSRFPILKNHKNGKLLTSS 425 Saccharomyces cerev...
AAC29144 308 GFHCPRCKAKVCTLPIECPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSANPKSTHCFACQLPFPKPPVSPFDESTSSM 387 fission yeast
Q13888   288 GYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG-----------ELKDQH 356 human
Q04673   426 RYRCEDCKQEFCVDCDVFIHEILHNCPGCESK 457 Saccharomyces cerevisiae S288c
AAC29144 388 RYACPSCKNHFCLDCDVFAHEQLHECYGCQCS 419 fission yeast
Q13888   357 VYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHK 388 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap