Conserved Protein Domain Family

TIGR00622: ssl1 
transcription factor ssl1
All proteins in this family for which functions are known are components of the TFIIH complex which is involved in the initiaiton of transcription and nucleotide excision repair.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
PSSM-Id: 129709
Aligned: 3 rows
Threshold Bit Score: 183.213
Threshold Setting Gi: 17380326
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q04673   426 RYRCEDCKQEFCVDCDVFIHEILHNCPGCESK 457 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap