Conserved Protein Domain Family
rect

?
TIGR00616: rect 
recombinase, phage RecT family
All proteins in this family for which functions are known bind ssDNA and are involved in the the pairing of homologous DNA This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). RecT and homologs are found in prophage regions of bacterial genomes. RecT works with a partner protein, RecE. [DNA metabolism, DNA replication, recombination, and repair, Mobile and extrachromosomal element functions, Prophage functions]
Statistics
?
PSSM-Id: 129703
View PSSM: TIGR00616
Aligned: 3 rows
Threshold Bit Score: 355.057
Threshold Setting Gi: 1176730
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33228     1 MTKQPPIAKADLQKTQGNRAPAAVKNSD-VISFINQpsMKEQLAAALPRHMTAERMIRIATTEIRKVPALGNCDTMSFVS 79  Escherichia coli K-12
CAA48054   2 ATKKQEELKNALAQQNGAVPQTPVKPQDkVKGYLER--MMPAIKDVLPKHLDADRLSRIAMNVIRTNPKLLECDTASLMG 79  Bacillus phage SPP1
P45908     2 ATNQS--IKNNIQKKQKNVP-VQQQGAT-MKGLLSSpsVIKRFEEVLG--KRATQFTASILSLYNSEQMLQKTDPMSVIS 75  Bacillus subtilis s...
P33228    80 AIVQCSQLGLEPGsALGHAYLLPFGNKNEKSgkKNVQLIIGYRGMIDLARRSGQIASLSARVVREGDEFSFEFGLDEKLI 159 Escherichia coli K-12
CAA48054  80 AVLESAKLGVEPG-LLGQAYILPYTNYKKKT--VEAQFILGYKGLLDLVRRSGHVSTISAQTVYKNDTFEYEYGLDDKLV 156 Bacillus phage SPP1
P45908    76 SAMVAATLDLPIDkNLGYAWIVPYGG---KA-----QFQLGYKGYIQLALRTGQYKSINCIPIHEGELQKWNPLTEEIEI 147 Bacillus subtilis s...
P33228   160 HRP---GENEDAPVThVYAVARLKDGGTQFEVMTRKQIELVR-SLSKAGNN-----GPWVTHWEEMAKKTAIRRLF-KYL 229 Escherichia coli K-12
CAA48054 157 HRPapfGTDRGEPVG-YYAVAKMKDGGYNFLVMSKQDVEKHRdAFSKSKNRegvvyGPWADHFDAMAKKTVLRQLI-NYL 234 Bacillus phage SPP1
P45908   148 DFE---KRESDAVIG-YAAYFELINGFRKTVYWTKAQVEKHKkKFSKSDFG-------WKNDWDAMALKTVLKAVLsKWG 216 Bacillus subtilis s...
P33228   230 PVSIEIQRAVSMDE 243 Escherichia coli K-12
CAA48054 235 PISVEQLSGVAADE 248 Bacillus phage SPP1
P45908   217 ILSVEMQKAVIEED 230 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap