1OYY,4O3M


Conserved Protein Domain Family
recQ_fam

?
TIGR00614: recQ_fam 
Click on image for an interactive view with Cn3D
ATP-dependent DNA helicase, RecQ family
All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129701
View PSSM: TIGR00614
Aligned: 10 rows
Threshold Bit Score: 767.01
Threshold Setting Gi: 531243
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OYY_A         15 QVLQETFGYQQFRPGQEEIIDTVLSGR-DCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAA 93   Escherichia coli
P71359         18 SVLKSVFGYQSFRKGQEEVINAALNGQ-DALVVMATGNGKSLCYQIPALCFDGLTLVISPLISLMKDQVDQLQANGIEAD 96   Haemophilus i...
BAA20269      502 NCLKTYFGHSSFKPVQWKVIHSVLEERrDNVVVMATGYGKSLCFQYPPVYTGKIGIVISPLISLMEDQVLQLELSNVPAC 581  house mouse
Q14191        538 TCLKMYFGHSSFKPVQWKVIHSVLEERrDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPAC 617  human
AAC63512      479 SCLKTYFGHSSFKPVQWKVVHSVLRERrDNLVVMATGYGKSLCYQFAPVYTSGIGIVICPLISLMEDQVLQLEMSNISSC 558  African clawe...
BAA07200       81 DILQNVFKLEKFRPLQLETINVTMAGK-EVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISAT 159  human
CAB10933      665 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIVDQVQKLTSFDIPAT 743  house mouse
WP_001099858   17 QVLQETFGYQQFRPGQEEIIDTVLSGR-DCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAA 95   Escherichia
P54132        657 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPAT 735  human
4O3M_A         18 KIFHKKFGLHNFRTNQLEAINAALLGE-DCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPAT 96   human
1OYY_A         94 CLNSTQTREQQLEVMTGC--RTGQIRLLYIAPERLMLDn-FLEHL----AHWNPVLLAVDEAHCISQWGHDFRPEYAALG 166  Escherichia coli
P71359         97 FLNSSQTLEQQQQVQNKL--ISGQLKLLYVSPEKVMTNs-FFQLI----SYSKVCFIAIDEAHCISQWGHDFRPEYTQLG 169  Haemophilus i...
BAA20269      582 LLGSAQSKN----ILGDV--KLGKYRVIYITPEFCSGNldLLQKLd---SSIGITLIAVDEAHCISEWGHDFRSSFRMLG 652  house mouse
Q14191        618 FLGSAQSEN----VLTDI--KLGKYRIVYVTPEYCSGNmgLLQQLe---ADIGITLIAVDEAHCISEWGHDFRDSFRKLG 688  human
AAC63512      559 FLGSAQSKN----VLQDV--KDGKMRVIYMTPEFCSRGisLLQDLd---NRYGITLIAIDEAHCISEWGHDFRSAYRSLG 629  African clawe...
BAA07200      160 MLNASSSKEHVKWVHAEMvnKNSELKLIYVTPEKIAKSkmFMSRLekayEARRFTRIAVDEVHCCSQWGHDFRPDYKALG 239  human
CAB10933      744 YLTGDKTDSEAANIYLQLskKDPIIKLLYVTPEKVCASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 823  house mouse
WP_001099858   96 CLNSTQTREQQLEVMTGC--RTGQIRLLYIAPERLMLDn-FLEHL----AHWNPVLLAVDEAHCISQWGHDFRPEYAALG 168  Escherichia
P54132        736 YLTGDKTDSEATNIYLQLskKDPIIKLLYVTPEKICASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 815  human
4O3M_A         97 YLTGDKTDSEATNIYLQLskKDPIIKLLYVTPEKICASnrLISTLenlyERKLLARFVIDEAHCVSQWGHDFRQDYKRMN 176  human
1OYY_A        167 QLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKF----KPLDQLMRYVQ--------EQ 234  Escherichia coli
P71359        170 GLKASFPDAPIMALTATADYATQQDILRHLNLKNLHKYIGSFDRPNIRYTLEEKY----KPMEQLTRFVL--------AQ 237  Haemophilus i...
BAA20269      653 SLKTALPLVPVIALSATASSSIREDIISCLNLKDPQITCTGFDRPNLYLEVGRKTg---NILQDLKPFLVrkas-sawEF 728  house mouse
Q14191        689 SLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTg---NILQDLQPFLVkts--shwEF 763  human
AAC63512      630 SLKRMLPNVPIVALTATASPSIREDITKSLNLHNPQVTCTSFDRPNLYLDVARKTt---NISIDLRQFLIkkqqgsgwEF 706  African clawe...
BAA07200      240 ILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTASFNRPNLYYEVRQKPsnteDFIEDIVKLINg-------RY 312  human
CAB10933      824 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 894  house mouse
WP_001099858  169 QLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKF----KPLDQLMRYVQ--------EQ 236  Escherichia
P54132        816 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 886  human
4O3M_A        177 MLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKp--kKVAFDCLEWIRk-------HH 247  human
1OYY_A        235 RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQ-RDDLQIVVATVAFGMGINKPNVRFVVHFDI 313  Escherichia coli
P71359        238 KGKSGIIYCNSRNKVERIAESLRNKGVSAAAYHAGMETAIRERVQQDFQ-RDNVQVVVATIAFGMGINKSNVRFVAHFDL 316  Haemophilus i...
BAA20269      729 EGPT-IIYCPSRKMTEQVTAELGKLNLACRTYHAGMKISERKDVHHRFL-RDEIQCVVATVAFGMGINKADIRQVIHYGA 806  house mouse
Q14191        764 EGPT-IIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFV-RDEIQCVIATIAFGMGINKADIRQVIHYGA 841  human
AAC63512      707 EGAT-IVYCPTRKTSEQVTAELIKLGIACGTYHAGMGIKQRREVHHRFM-RDEIHCVVATVAFGMGINKPDIRKVIHYGA 784  African clawe...
BAA07200      313 KGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKWS-ANEIQVVVATVAFGMGIDKPDVRFVIHHSM 391  human
CAB10933      895 PYDSGIIYCLSRRECDTMADTLQREGLAALAYHAGLSDSARDEVQHKWInQDNCQVICATIAFGMGIDKPDVRFVIHASL 974  house mouse
WP_001099858  237 RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQ-RDDLQIVVATVAFGMGINKPNVRFVVHFDI 315  Escherichia
P54132        887 PYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWInQDGCQVICATIAFGMGIDKPDVRFVIHASL 966  human
4O3M_A        248 PYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWInQDGCQVICATIAFGMGIDKPDVRFVIHASL 327  human
1OYY_A        314 PRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQ---LQDIERHKLNAMGAFAEAQTCRRLVLLNYFG 390  Escherichia coli
P71359        317 PRSIESYYQETGRAGRDDLPAEAVLFYEPADYAWLQKILLEKPETP---QRQIEQHKLEAIGEFAESQTCRRLVLLNYFG 393  Haemophilus i...
BAA20269      807 PKEMESYYQEIGRAGRDGLQSSCHLLWAPADFNTSRNLLIEIHDEK---FRLYKLKMMVKMEKYLHSSQCRRRIILSHFE 883  house mouse
Q14191        842 PKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEK---FRLYKLKMMAKMEKYLHSSRCRRQIILSHFE 918  human
AAC63512      785 PKEMESYYQEIGRAGRDGLPSCCHALWAQADMNFNRHMLGEIPNKG---FREYKLKMLTKMEKYLNSSTCRRKIILSHFE 861  African clawe...
BAA07200      392 SKSMENYYQESGRAGRDDMKADCILYYGFGDIFRISSMVVMENVG----QQ----KLYEMVSYCQNISKCRRVLMAQHFD 463  human
CAB10933      975 PKSMEGYYQESGRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGNyhtKETHVNNLYSMVHYCENITECRRIQLLAYFG 1054 house mouse
WP_001099858  316 PRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQ---LQDIERHKLNAMGAFAEAQTCRRLVLLNYFG 392  Escherichia
P54132        967 PKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNhhtRETHFNNLYSMVHYCENITECRRIQLLAYFG 1046 human
4O3M_A        328 PKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNhhtRETHFNNLYSMVHYCENITECRRIQLLAYFG 407  human
1OYY_A        391 E-----------GRQEPCGNCDICLD--------PPKQYDGSTDAQIALSTIGRVN-------QRFGMGYVVEVIRGANN 444  Escherichia coli
P71359        394 E-----------HRQTPCNNCDICLD--------PPKKYDGLVDAQKVMSTIYRVG-------QCFGAHYVIAVLRGMHN 447  Haemophilus i...
BAA20269      884 DkclqkasldimGTEKCCDNCRPRLNhcltannsEDASQDFGPQAFQLLSAVDILQ-------EKFGIGIPILFLRGSNS 956  house mouse
Q14191        919 DkqvqkaslgimGTEKCCDNCRSRLDhcysmddsEDTSWDFGPQAFKLLSAVDILG-------EKFGIGLPILFLRGSNS 991  human
AAC63512      862 DkqlrkassgimGTEKCCDNCKTRLIcnisindtEDNLQDFGPQAYKFISAVDVLG-------QKFGTGVPVLFLRGSTS 934  African clawe...
BAA07200      464 Evwn------seACNKMCDNCCKDSAfer--kniTEYCRDLIKILKQAEELNEKLt------pLKL-----IDSWMGKGA 524  human
CAB10933     1055 Ekgfnp-dfckkYPDVSCDNCCKTKDykt--kdvTDDVKNIIRFVQEHSSSPGTRnig---paGRFTLNMLVDIFLGSKS 1128 house mouse
WP_001099858  393 E-----------GRQEPCGNCDICLD--------PPKQYDGSTDAQIALSTIGRVN-------QRFGMGYVVEVIRGANN 446  Escherichia
P54132       1047 Engfnp-dfckkHPDVSCDNCCKTKDykt--rdvTDDVKSIVRFVQEHSSSQGMRNikhvgpsGRFTMNMLVDIFLGSKS 1123 human
4O3M_A        408 Engfnp-dfckkHPDVSCDNCCKTKDykt--rdvTDDVKSIVRFVQEHSSSQGMRNikhvgpsGRFTMNMLVDIFLGSKS 484  human
1OYY_A        445 QRIRDYGHDKLKVYGMGRDK 464  Escherichia coli
P71359        448 QKIIERQHHKLSVYGIGKDK 467  Haemophilus influenzae Rd KW20
BAA20269      957 QRLPDK-YRGHRLFGAGKEQ 975  house mouse
Q14191        992 QRLADQ-YRRHSLFGTGKDQ 1010 human
AAC63512      935 QRVPDR-FRNHSLFSSGKDQ 953  African clawed frog
BAA07200      525 AKLRVAGVVAP-TLPREDLE 543  human
CAB10933     1129 AKVKSGIFGKGTTYSRHNAE 1148 house mouse
WP_001099858  447 QRIRDYGHDKLKVYGMGRDK 466  Escherichia
P54132       1124 AKIQSGIFGKGSAYSRHNAE 1143 human
4O3M_A        485 AKIQSGIFGKGSAYSRHNAE 504  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap