1KN0


Conserved Protein Domain Family
rad52

?
TIGR00607: rad52 
Click on image for an interactive view with Cn3D
recombination protein rad52
All proteins in this family for which functions are known are involved in recombination and recombination repair. Their exact biochemical activity is not yet known.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129695
View PSSM: TIGR00607
Aligned: 8 rows
Threshold Bit Score: 310.201
Threshold Setting Gi: 2959375
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KN0_A    38 AIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN--GKFYVGVCAFVRVQL 115 human
P43352    39 AIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN--GKFYVGVCAFVKVQL 116 house mouse
P43351    38 AIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNN--GKFYVGVCAFVRVQL 115 human
P39022    39 AIQHALRQKLGPEYISSRQAGGGQKVCYIEGHKVISLANEMFGFNGWAHSVTQQNVDFVDLNN--GRFYVGVCAFVKVQL 116 chicken
P06778    20 DIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQIFGYNGWSTEVKSVVIDFLDERQ--GKFSIGCTAIVRVTL 97  Saccharomyces cerev...
P41768    13 DIQTKLDKKLGPEYISKRVGFGSSRVAYIEGWKAINLANQIFGYDGWSTEVKNVTIDFLDERQ--GRFSIGCTAIVRVSL 90  Kluyveromyces lacti...
CAA17929  20 KMTKLLAMQLGPEYISRRSGPGGGSVTYLEAWKAIELANEIFGFNGWSSSIQDIHVDYVEETKe-KKFNVGISVIVRVTL 98  fission yeast
P36592    28 FLQSSLTRKLGPEYVSRRSGPGGFSVSYIESWKAIELANEIFGFNGWSSSIRSINVDFMDENKenGRISLGLSVIVRVTI 107 Schizosaccharomyces...
1KN0_A   116 KDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPrQLPLEVDLTKAKRQD 195 human
P43352   117 KDGSYHEDVGYGVSEGLRSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPrQLPLDVDLTKTKRED 196 house mouse
P43351   116 KDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPrQLPLEVDLTKAKRQD 195 human
P39022   117 KDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALKCFGNALGNCILDKDYLQAVNKLPrQMPPELDLVKTKRQD 196 chicken
P06778    98 TSGTYREDIGYGTVENERRKPAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVK-FDPPDFDENNLFRPT 176 Saccharomyces cerev...
P41768    91 ADGTFREDIGYGTVENERRKASAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVK-FDPPDFDEGNLFRPA 169 Kluyveromyces lacti...
CAA17929  99 KDGSFHEDVGYGSIENCRVKALAYEKCKKEGTTDALKRALRNFGSSMGNCLYDKRYIQKILKMA-PAQAEFNYDNLLRAN 177 fission yeast
P36592   108 KDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDALKRALRNFGNSLGNCMYDKYYLREVGKMK-PPTYHFDSGDLFRKT 186 Schizosaccharomyces...
1KN0_A   196 LEPS 199 human
P43352   197 FEPS 200 house mouse
P43351   196 LEPS 199 human
P39022   197 YEPE 200 chicken
P06778   177 DEIS 180 Saccharomyces cerevisiae S288c
P41768   170 DELS 173 Kluyveromyces lactis NRRL Y-1140
CAA17929 178 KRPY 181 fission yeast
P36592   187 DPAA 190 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap