Conserved Protein Domain Family
rad50

?
TIGR00606: rad50 
rad50
All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Statistics
?
PSSM-Id: 129694
View PSSM: TIGR00606
Aligned: 4 rows
Threshold Bit Score: 1596.24
Threshold Setting Gi: 2687855
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB07119    2 SRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQ 81   human
CAA99729    8 DMFAKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQ 87   human
AAC52894    2 SRIEKMSILGVRSFGIEDKDKQIISFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQ 81   house mouse
CAA99730    2 AKFLRLHIRGIRSVGDEDHDVHKIDFLSPCTLISGPNGTGKTTTIEALNFVTTGQMPTQKKQN-FIHSTDVARKTRVDAS 80   Caenorhabditis el...
AAB07119   82 IRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQED 161  human
CAA99729   88 IRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQED 167  human
AAC52894   82 IRLQFRDVNGEMVAVHRSMLCSQKNKKTEFKTLEGVITRMKHGEKVSLSSKCAEIDREMISCLGVSKSVLNNVIFCHQED 161  house mouse
CAA99730   81 VTLEFIDVKGRECTAVRRLVVTSGTKAAALAEEHTLAIKYPDGTVNTLSSKVCDFNTALLKHLGVPRAVFKYVIFCHQED 160  Caenorhabditis el...
AAB07119  162 SNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLTSSKEIV 241  human
CAA99729  168 SNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVEEYQMELKYLKQYKEKACEIRDQITSKEAQLTSSKEIV 247  human
AAC52894  162 SNWPLSEGKALKQKFDEIFSATRYIKALDTLRQVRQTQGQKVKECQTELKYLKQNKEKACEIRDQITSKEAQLASSQEIV 241  house mouse
CAA99730  161 STWPLSEPKELKKRFDDIFQLTKFVKAQERMKKIVLDFKKEMQTHEMSKQLYET------HVRDKLVARQNQEECERKIS 234  Caenorhabditis el...
AAB07119  242 KSYENELDPLKNR----LKEIEHNLSKIMKLDNEIKALDSRKKQMEKDNSELEEKMEKVFQGTDEQLN-DLYHNHQRTVR 316  human
CAA99729  248 KSYENELDPLKNR----LKEIEHNLSKIMKLDNEIKALDSRKKQMEKDNSELEEKMEKVFQGTDEQLN-DLYHNHQRTVR 322  human
AAC52894  242 RSYEDELEPLKNR----LKEIEHNLSKIMKLDNEIKALESRKKQMEKDNSELEQKMEKVFQGTDEQLN-DLYHNHQRTVR 316  house mouse
CAA99730  235 KRKE-ETDELKERkangQKKIEEMRTSIHELEDTLTSFKKTELERQNLKKQLSLIRVEPYFGTEEELKrEIEEFRGSEGR 313  Caenorhabditis el...
AAB07119  317 EKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNF 396  human
CAA99729  323 EKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNF 402  human
AAC52894  317 EKERRLVDCQRELEKLNKEARLLNQEKAELLVEQGRLQLQADRHQEHIRARDSLIQSLATHLELDGFERGPFSERQIKNF 396  house mouse
CAA99730  314 SYGEERARIQKKIGKNNQERQELSQKKTEFENRIS--SLKAEVIHCQSLKYDLERLENQLRSELD-LEHDADIDIEIDNA 390  Caenorhabditis el...
AAB07119  397 HKLVRERQEGEAKTANQLMNDFAEKETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILE 476  human
CAA99729  403 HKLVRERQEGEAKTANQLMNDFAEKETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILE 482  human
AAC52894  397 HELVKERQEREAKTASQLLSDLTDKEALKQRQLDELRDRKSGLGRTIELKTEILTKKQSELRHVRSELQQLEGSSDRILE 476  house mouse
CAA99730  391 ITLKIRGMSDKARMIAKNCAELQSNLRTAQEAATKIEVEMK----TLQNEKVKLEKEVEQLKFKIKQGQNATAGMKDLLK 466  Caenorhabditis el...
AAB07119  477 LDQELIKAERELSKAEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEMLTKDKADKDEQIRKIK 556  human
CAA99729  483 LDQELIKAERELSKAEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEMLTKDKADKDEQIRKIK 562  human
AAC52894  477 LDQELTKAERELSKAEKNSSIETLKAEVMSLQNEKADLDRSLRKLDQEMEQLNHHTTTRTQMEMLTKDKTDKDEQIRKIK 556  house mouse
CAA99730  467 KEEALRKSLADLPLLDENALTECKLKREKYLK--QLDILKKKCAEAEKNAEKDREKESLKQTLSIARKKMTAYQRIYDNN 544  Caenorhabditis el...
AAB07119  557 SRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASSEQNKNHINNELKRKEEQLSSYEDKLFDVCGSQ 636  human
CAA99729  563 SRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASSEQNKNHINNELERKEEQLSSYEDKLFDVCGSQ 642  human
AAC52894  557 SRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASAEQNKNHINNELKKKEEQLSSYEDKLFDVCGSQ 636  house mouse
CAA99730  545 WQG---LIGQAPDFPWTPILSKTFHKLRNDKKIMEEDLRDVQLNVQKLETMQHQYRKQEESLTAQELKLSENIFEACSCE 621  Caenorhabditis el...
AAB07119  637 DFES--DLDRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKS 714  human
CAA99729  643 DFES--DLDRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEAISDLQSKLRLAPDKLKS 720  human
AAC52894  637 DLES--DLGRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKS 714  house mouse
CAA99730  622 AEEVseKLENLRKRLKKARKDLAPLSAKSNLYDSYIEES--KSSGCCPLCDRDFKTKKEINEFSKKLENMTLSFPTEQEE 699  Caenorhabditis el...
AAB07119  715 TESELKKKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMPEEESAKVCLTDVTI 794  human
CAA99729  721 TESELKKKEKRRDEMLGLAPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMPEEESAKVCLTDVTI 800  human
AAC52894  715 TESELKKKERRRDEMLGLVPVRQSIIDLKEKEIPELRNRLQSVNRDIQRLKNDIEEQETLLGTIMPEEESAKVCLTDVTI 794  house mouse
CAA99730  700 LEKLVSKLEKE-EIIIVKAEGQANELQRIVKELKEVREKNRKLSTEMAEEKSNLSKNEKQLETVNAKLKLAEDLQTDVGV 778  Caenorhabditis el...
AAB07119  795 MERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLDTVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEK 874  human
CAA99729  801 MERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLDTVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEK 880  human
AAC52894  795 MERFQMELKDVERKIAQQAAKLQGVDLDRTVQQVNQEKQEKQHRLDTVTSKIELNRKLIQDQQEQIQHLKSKTNELKSEK 874  house mouse
CAA99730  779 IQQLYEQTEENEKRYEQLVSESDSSDG-LSYTELRKKVEDKDEEYRKIVQEGEELQKCSEERNK----LQSKLNELGTHR 853  Caenorhabditis el...
AAB07119  875 LQISTNLQRRQQLEEQTVELSTEVQSLYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNI 954  human
CAA99729  881 LQISTNLQRRQQLEEQTVELSTEVQSLYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNI 960  human
AAC52894  875 LQIATNLQRRQQMEEQSVELSTEVQSLNREIKDAKEQISPLETALEKLQQEKEELIHRKHTSNKMAQDKINDIKEKVKNI 954  house mouse
CAA99730  854 VSLGEAAAQAGAFAEQLETKIKEIQECITAISQKRNEDLPDAQFKKDDLTRN---VSSKEEEKKKAEMEVQMMKKELDQK 930  Caenorhabditis el...
AAB07119  955 HGYMKDIENYIQDG--KDDYKKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQDNLTLRKRNEELK 1032 human
CAA99729  961 HGYMKDIENHIQDG--KDDYMKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQDNLTLRKRNEELK 1038 human
AAC52894  955 HGYMKDIENYIQDG--KDDYKKQKETELNGVAVQLNECEKHREKINKDMGTMRQDIDTQKIQERWLQDNLTLRKRRDELK 1032 house mouse
CAA99730  931 IFHRKSLFKKVQEGglCERQLMDKENNIATLNASLEENQQRQKRFEEDLR----SFDSSHQRESILKDQLTRMIIENKIK 1006 Caenorhabditis el...
AAB07119 1033 EVEEERKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMR 1112 human
CAA99729 1039 EVEEEGKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMR 1118 human
AAC52894 1033 EVEEEPKQHLKEMGQMQVLQMKNEHQKLEENIDTIKRNHSLALGRQKGYEDEILHFKKELREPQFRDAEEKYREMMIVMR 1112 house mouse
CAA99730 1007 ELKRTLATFDGQINEDRITEQKQAYNKLQNELRLIGNEEVKIYTQMQEYEKQKKIAEAKLSTKECQNAESNYRDAIIELA 1086 Caenorhabditis el...
AAB07119 1113 TTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGD 1192 human
CAA99729 1119 TTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGD 1198 human
AAC52894 1113 TTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGD 1192 house mouse
CAA99730 1087 ITKESISDLTKYRNCLDASLIQFHSEKMGRVNGIIDDLWRKVYNSTDITTIRIRSDATSETSSKKVAYEYNVMMVHETG- 1165 Caenorhabditis el...
AAB07119 1193 TALDMRGRCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRS--------QQRNFQL 1264 human
CAA99729 1199 TALDMRGRCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRS--------QQRNFQL 1270 human
AAC52894 1193 TALDMRGRCSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRS--------QQRNFQL 1264 house mouse
CAA99730 1166 TEVEMRGRCSAGQKMLASLLIRIALAEVFGGSCSMIALDEPTTNLDESKVEGMAIVLADIIAERRgfdengklRGRDMQM 1245 Caenorhabditis el...
AAB07119 1265 LVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH 1312 human
CAA99729 1271 LVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH 1318 human
AAC52894 1265 LVITHDEDFVELLGRSEYVEKFYRVKKNMDQCSEIVKCSISSLGSYVH 1312 house mouse
CAA99730 1246 VVITHDERLVNRITISCRPEYIYCLGKDEHGISFLSKRYPDGTVKRVN 1293 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap