Conserved Protein Domain Family
rad24

?
TIGR00602: rad24 
checkpoint protein rad24
All proteins in this family for which functions are known are involved in DNA damage tolerance (likely cell cycle checkpoints).This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129690
View PSSM: TIGR00602
Aligned: 4 rows
Threshold Bit Score: 809.954
Threshold Setting Gi: 1709996
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA06251   2 NQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLessrFPARKRGNLSsLEQIYGLENSKEYLSENEPWV 81  human
CAA09868  13 TKVEDWVAPAFDDFEANTAITTITASSLTFSNSSHRRKYLPSTLesnrLSARKRGRLS-LEQTHGLETSRERLSDNEPWV 91  house mouse
P50531     1 MRRQLSFHESTKRSLKKKKIRKIEKPSLVSKTS--RDKNASITD----IHEEDIEAFS-DEENKIVHLNNLKEDRFQLWF 73  Schizosaccharomyces...
P32641     1 MDSTNLNKRPLLQYSLSSLGSQITKWSSSRPTSPVRKARSTEND-----------FLS--KQDTSSILPSINDDGGEQWY 67  Saccharomyces cerev...
CAA06251  82 DKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQggsILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKD 161 human
CAA09868  92 DKYKPETQHELAVHKKKIEEVETWLKAQVLEVKPKQggsVLLITGPPGCGKTTTIKILSKELGIQVQEWVNPILPDFQKD 171 house mouse
P50531    74 EKYIPQKAADLAVHKSKISAIKQWMLTDSLES---R---LLLICGPSGCGKSTAVQVLAKELGYSLIEWLNPMNLKEPSN 147 Schizosaccharomyces...
P32641    68 EKFKPNCLEQVAIHKRKLKDVQEALDAMFLPNAKHR---ILLLSGPSGCSKSTVIKELSKILVPKYRQNSNGTSFRSTPN 144 Saccharomyces cerev...
CAA06251 162 DFKGMFNTESSFHMFpyQSQIAVFKEFLLRATkyNKLQMLGDDLRTDKKIILVEDLP--NQFYRDSH--TLHEVLR-KYV 236 human
CAA09868 172 DYKELLSLESNFSVVpyQSQIAVFNDFLLRATkySKLQMLGDDLTTDKKIILVEELP--NQFYRDPN--ALHEILR-KHV 246 house mouse
P50531   148 QESDTLSLTEKFSRF--MSLCETYPELELMDS--NNIQKRGKNAQGKKKFIFLDEIPhlSKFNGSLD--AFRNVIRtALT 221 Schizosaccharomyces...
P32641   145 EHKVTEFRGDCIVND--LPQMESFSEFLKGAR------YL---VMSNLSLILIEDLP--NVFHIDTRrrFQQLILQwLYS 211 Saccharomyces cerev...
CAA06251 237 RIGRCP-LIFIISDS----LSGDNNQ-----RLLFP------KEIQEECSISNISFNPVAPTIMMKFLNRIVTIEANKNG 300 human
CAA09868 247 QIGRCP-LVFIVSDS----VSGDNNQ-----RLLFP------RNIQEECSVSNISFNPVAPTIMMKFLNRIVTIEASKNG 310 house mouse
P50531   222 SRGAFS-IIMVLTEIqlnnLEGINSQd----RNSFNsvqimgNDLLQDPRVTVLQFNPIAPTYMKKCLGSILRKEGVPKS 296 Schizosaccharomyces...
P32641   212 SEPLLPpLVICITECei--pENDNNYrkfgiDYTFSaetimnKEILMHPRLKRIKFNPINSTLLKKHLKFICVQNMKMLK 289 Saccharomyces cerev...
CAA06251 301 GKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGenNLRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKD 380 human
CAA09868 311 EKIIVPNKTSLELLCQGCSGDIRSAINSLQFSSSKGenSSWSKKKRMSLKSDAAISKSKQKKKHNSTLENQEIQAIGGKD 390 house mouse
P50531   297 PKLLS----LVENICSASEGDLRSAINSLQLSISQS-------FEKKGTKNIREVKEGKGKGNDFSLEAAQVLERLSKSD 365 Schizosaccharomyces...
P32641   290 EKNKWNKRQEVIDYIAQETGDIRSAITTLQFWATSS--GSLPISTRESTISYFHAIGKVIHGSHSTNNDNEMINNLFENS 367 Saccharomyces cerev...
CAA06251 381 VSLFLFRALGKILYCKRASLTELDS--PRLPSHLSEYERDTLLVEPEEVVEMSHMPGD-LFNLYLHQNYIDFFMEIDDIV 457 human
CAA09868 391 VSLFLFRALGKILYCKRAPLTELDS--PRLPAHLSEHDRDTLLVQPEEIVEMSHMPGD-FFNLYLHQNYIDFFAEVDDLV 467 house mouse
P50531   366 SEAYARFKNYKSAYIPKSDKNEN--------SFFKKDVGLGMMHAIGKVVWNKREGDDeVLKASSQQTGNSERIKGVKVS 437 Schizosaccharomyces...
P32641   368 NNLLSKEDFKLGILENYNTFNKGEFsiSDASSIVDCLSECDNMNGLPESNEYGLREVRkTFRNISKQGHNHGTVYFPREW 447 Saccharomyces cerev...
CAA06251 458 RASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSN-KARGYAHCQGGgSSFRPLHKPQWFLINKKYRENCLAAKALF 536 human
CAA09868 468 PASEFLSFADILGGDWNTRSLLREYSTSVATRGVMHSN-KARGFAHCQGG-SSFRPLHKPQWFLIQKKYRENCLAAKALF 545 house mouse
P50531   438 KSQENKNCISLKS-DQRERMLNVDQCFTSKRRSLVDIE-STINQSGLSGS--VFR------YGLF-ENYVDSCVTTDEAF 506 Schizosaccharomyces...
P32641   448 KVRKLQNSFKVQAEDWLNVSLYKYNAVHSFRNITLEFGyYAPLIRKCQSYkKKYILYYLKNLPSGSSGPKQTMDKFSDIM 527 Saccharomyces cerev...
CAA06251 537 --PDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGgHSA 614 human
CAA09868 546 --VDFCLPALCLQTQLLPYLALLTIPMRNKAQISFIPDVGRLPLKRSFGRLKMEALTDRELGLIDPDSGDESAQRG-QPA 622 house mouse
P50531   507 nvCDLLSISDCLSHDFPYSYTGDEISTWFSVQGTLFYLPS--PVPRKWRQLRFQQWNN--EGIVRGIFDDYMVIYG---- 578 Schizosaccharomyces...
P32641   528 kvENGIDVVDRIGGPIEALSVEDGLAPLMDNDSNNCDHLEDQKKERDRRLRMLIDQYERNVMMANDDLEDEETSFNdDPI 607 Saccharomyces cerev...
CAA06251 615 EESLGEPTQATV---PETWSLPLSQNSASE 641 human
CAA09868 623 QEAPGEPAQAAQnadPETWSLPLSQNSGSD 652 house mouse
P50531   579 KRSVSDPVIEAH----EDQVLEDIDDPIED 604 Schizosaccharomyces pombe 972h-
P32641   608 VDSDSDNSNNIG---NETFGRSDEDESLCE 634 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap