2JNW


Conserved Protein Domain Family
rad10

?
TIGR00597: rad10 
Click on image for an interactive view with Cn3D
DNA repair protein rad10
All proteins in this family for which functions are known are components in a multiprotein endonuclease complex (usually made up of Rad1 and Rad10 homologs). This complex is used primarily for nucleotide excision repair but also for some aspects of recombination repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129685
View PSSM: TIGR00597
Aligned: 5 rows
Threshold Bit Score: 185.038
Threshold Setting Gi: 131776
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JNW_A  18 NSIIVSPRQRGNPVLKFVRNVPWEFG-----DVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQV 92  human
P07903  99 NSIIVSPRQRGNPVLKFVRNVPWEFG-----EVIPDYVLGQSTCALFLSLRYHNLHPDYIHERLQSLGKNFALRVLLVQV 173 house mouse
Q06182  41 HSILVNPRQKGNPLLPHVRNVPWEYT-----DIVPDFVMGTGICSLFLSLKYHHLHPEYIYSRISKLGKSYNLRILLILV 115 Schizosaccharomyces p...
P06838  91 KTVLVNTTQKENPLLNHLKSTNWRYVsstgiNMIYYDYLVRGRSVLFLTLTYHKLYVDYISRRMQPLSRNENN-ILIFIV 169 Saccharomyces cerevis...
P07992  99 NSIIVSPRQRGNPVLKFVRNVPWEFG-----DVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQV 173 human
2JNW_A  93 DVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE 129 human
P07903 174 DVKDPQQALKELAKMCILADCTLVLAWSAEEAGRYLE 210 house mouse
Q06182 116 DVENHQASIQELVKTSIVNQYTLILAWSSEEAARYLE 152 Schizosaccharomyces pombe 972h-
P06838 170 DDNNSEDTLNDITKLCMFNGFTLLLAFNFEQAAKYIE 206 Saccharomyces cerevisiae S288c
P07992 174 DVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE 210 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap