Conserved Protein Domain Family
phr2

?
TIGR00591: phr2 
photolyase PhrII
All proteins in this family for which functions are known are DNA-photolyases used for the direct repair of UV irradiation induced DNA damage. Some repair 6-4 photoproducts while others repair cyclobutane pyrimidine dimers. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129679
View PSSM: TIGR00591
Aligned: 7 rows
Threshold Bit Score: 471.193
Threshold Setting Gi: 1197525
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA67683   5 VSVQPGRIRILKKgSWQPSDQTVGPVVYWMFRDQRLKDNWALIHAVDLANRTNAPVAVVFNL-FDQFLDAKARQLGFMLK 83  thale cress
BAA05042 178 FSFRKKRVRVLSK-TEDVKESSLGGVVYWMSRDGRVQDNWALLFAQRLALKLELPLTVVFCL-VPKFLNATIRHYKFMMG 255 fruit fly
BAA06700  14 FRFNKQRVRLISQ-DCHLQDHSQA-FVYWMSRDQRVQDNWAFLYAQRLALKQKLPLHVCFCL-APCFLGATIRHYDFMLR 90  gray short-tailed o...
BAA05043  49 MKFSKKRQRFISE-TQKVRQGSGG-VLYWMLRDQRVQDNWALIRAQQLAAKESLPLHVCFCLvVPKSELSTLRHYSFLLK 126 Japanese medaka
P34205    87 CEVNKKRLRYLSD-TQKIKQGSDG-FLYWMSRDQRVQDNWALIYAQQLALAEKLPLHICFCL-VPRYLDATYRQYAFMLK 163 goldfish
P12769     1 MIHAERIRNLNGE--E-PDLRGSYVVYWMQASVRSHWNHALEYAIETANSLKKPLIVVFGLT-DDFPNANSRHYRFLIEG 76  Methanothermobacter...
AAC43723     --------------------------------------------------------------------------------     Myxococcus xanthus ...
CAA67683  84 GLRQLHHQIDSLQIPFFLLQG-DAKETIPNFLTE-CGASHLVTDFSPLREIRRCKDEVVKRTSDSLAIHEVDAHNVVPMW 161 thale cress
BAA05042 256 GLQEVEQQCRALDIPFHLLMG-SAVEKLPQFVKS-KDIGAVVCDFAPLRLPRQWVEDVGKALPKSVPLVQVDAHNVVPLW 333 fruit fly
BAA06700  91 GLEEVAEECEKLHIPFHLLLG-LPKDVLPAFVQA-HSIGGIVTDFSPLLHHTQWVKDVQDGLPKQVPFVQVDAHNIVPCW 168 gray short-tailed o...
BAA05043 127 GLEEVQKECKHLNIQFHLLHG-AAGDVLPGFVTG-HNFGAVVTDFSPLREPLQWLEAVKKGLPEDIPFIQVDAHNIVPCW 204 Japanese medaka
P34205   164 GLQEVAKECKSLDIQFHLLSG-EPGQNLPSFVEK-WKFGAVVTDFNPLRIPLQWIETVKKHLPADVPFIQVDAHNVVPCW 241 goldfish
P12769    77 LRDVRSNLRERGIQLVVERDS-PPSVLLKYADD---AAAAVTDRGYLDIQKEWVDEAAGALH--IPLTQVESNVIVPVET 150 Methanothermobacter...
AAC43723   1 --MDMATGCAARGLPYWLELPrTSKEHRPRLAQLgRRAAAIVSDLFPTYIIPGHLRGAAKAL--DVPLFAVDASCVVPMQ 76  Myxococcus xanthus ...
CAA67683 162 AASSKLEYSARTIRGKINKLLPDYLI-EFPKLEPPKKk-----wTGMMDKKLVDWDSLIDKVVREgAEVPEIEWCVPGED 235 thale cress
BAA05042 334 VASDKQEYAARTIRNKINSKLGEYLS-EFPPVVRHPHg------TGCKNVNTVDWSAAYASLQCD-MEVDEVQWAKPGYK 405 fruit fly
BAA06700 169 IASDKQEYGARTIRHKIHDRLPHFLT-EFPPVICHPY-------PSNIQAEPVDWNACRAGLQVD-RSVKEVSWAKPGTA 239 gray short-tailed o...
BAA05043 205 VASPKLEYSARTIRGKITNLLSEFLT-DFPLVDKHPF-------SATKTAKAVDWDKTLASLKVD-RTVGEPKLAKPGTE 275 Japanese medaka
P34205   242 EASGKLEYGARTIRGKITKLLPEFLT-EIPLVDTHPH-------SASRAAEPVDWEEVLSSLEVE-RSVGEVDWAQPGTS 312 goldfish
P12769   151 ASDKEEYSAGTFKPKIKRHLKRFMVP-LRMRTLKMDS--------LDLEPGPEFEDAVRDFRAPE--DLEPSVFRGGTST 219 Methanothermobacter...
AAC43723  77 RIATR-QIGAYTLRPKLKKLWPEYLDrAVPNRAVKAAaagrklePDFATSDARESRESLDAFDFD-HSVAPIQE-RGGRK 153 Myxococcus xanthus ...
CAA67683 236 AGIEVLMGnkdgFLTKRLKNYSTDRNNPIKpKALSGLSPYLHFGQVSAQRCALEARKVRSTSPQAVDIFLEELIVRRELS 315 thale cress
BAA05042 406 AACQQLYE----FCSRRLRHFNDKRNDPTA-DALSGLSPWLHFGHISAQRCALEVQRFRGQHKASADAFCEEAIVRRELA 480 fruit fly
BAA06700 240 SGLTMLQS----FISQRLPYFGSDRNNPNK-DALSNLSPWFHFGQVSVQRAILEVQKHRSRYPDSVANFVEEAVVRRELA 314 gray short-tailed o...
BAA05043 276 AGLAMLES----FIDVRLKLFGTQRNDPNA-AALSQLSPWLRFGQLSAQRVALQVR---KNSSPSVPAFIEELVVRRELT 347 Japanese medaka
P34205   313 GGMNMLES----FIDQRLRLFATHRNNPNY-DALSHLSPWIHTGQLSAQRVVKQVKRE-KNASESVASFIEELVVRRELA 386 goldfish
P12769   220 ALSIFSEF----LREKLECFERYRNDPVKN-CLSNMSPYLHFGQISPLYLALRASE-----AGECPEFLEELIVRRELSM 289 Methanothermobacter...
AAC43723 154 AGLDALQA----FVHQRLEGYDEGRNDPGL-ARQSNLSPFFHWGNLFAGEAARAAIRARGAQDASVQGFLEELLVRRELG 228 Myxococcus xanthus ...
CAA67683 316 DNFCYYQ--PHYDSLKGAWEWARKSLMDHASDKREHIYSLEQLEKGLTADPLWNASQLEMLYQGKMHGFMRMYWAKKILE 393 thale cress
BAA05042 481 DNFCFYN--EHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSLTYDDLWNSAQLQLVREGKMHGFLRMYWAKKILE 558 fruit fly
BAA06700 315 DNFCFYN--KNYDKLEGAYDWAQTTLRLHAKDKRPHLYSLEQLESGKTHDPLWNAAQMQMVQEGKMHGFLRMYWAKKILE 392 gray short-tailed o...
BAA05043 348 DNFCFYN--KNYDSVTGAYEWAQKTLKDHAKDKREYLYTREQFEKAQTHDKLWNAAQIQMVTEGKMHGFLRMYWAKKILE 425 Japanese medaka
P34205   387 DNFCFYN--PSYDNISGAYDWAKKTLQDHAKDSRQYLYTKEQLENAKTHDQLWNAAQRQLVSEGKMHGFLRMYWAKKILE 464 goldfish
P12769   290 NFVHYSD--SYSSISCLPEWAQRTLMDHVADPREYEYSLRELESASTHDPYWNAAQQEMVITGKMHGYMRMYWGKKILEW 367 Methanothermobacter...
AAC43723 229 FNYCFHTpgPQQLSVASLPPWAKETLTRHQKDAREHRYSLKQLETARTADGLWNAAQRELVERGRIHNYLRMLWGKKILE 308 Myxococcus xanthus ...
CAA67683 394 WTKGPEEALSISIYLNNKYEIDGRDPSGYVGCMWSICGVHDQGWKERPVFGKIRYMNYAGCKRKFNVDSYISYV 467 thale cress
BAA05042 559 WTATPEHALEYAILLNDKYSLDGRDPNGYVGCMWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRY 632 fruit fly
BAA06700 393 WTRSPEEALEFAIYLNDRFQLDGRDPNGYVGCMWSICGIHDQGWAEREIFGKIRYMNYAGCKRKFDVAEFERKY 466 gray short-tailed opossum
BAA05043 426 WSTSPEEALSIALYLNDRYELDGQDPNGFVGCMWSICGIHDQGWAERAVFGKIRFMNYKGCLRKFNVAQFERKY 499 Japanese medaka
P34205   465 WTASPEEALSIAIYLNDRLSLDGCDPNGYVGCMWSICGIHDQGWAERPIFGKIRFMNYAGCKRKFDVAQFERKY 538 goldfish
P12769   368 TDHPARAYDIALYLNDRYEIDGRDPNGFAGVAWCFG-KHDRAWAEREIFGKVRYMNDRGLKRKFRIDEYVDRIR 440 Methanothermobacter therm...
AAC43723 309 WTPSPQEALQRIAFLNDKYAVDGRDPASVANFMWVL-GLHDRPFQERQVLGKVRPMSSLRTAARYNLAPYLERW 381 Myxococcus xanthus DZF1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap