1EKR,4FDF


Conserved Protein Domain Family
moaC

?
TIGR00581: moaC 
Click on image for an interactive view with Cn3D
molybdenum cofactor biosynthesis protein MoaC
MoaC catalyzes an early step in molybdenum cofactor biosynthesis in E. coli. The Arabidopsis homolog Cnx3 complements MoaC deficiency in E. coli. Eukarotic members of this family branch within the bacterial branch, with the archaeal members as an apparent outgroup. This protein is absent in a number of the pathogens with smaller genomes, including Mycoplasmas, Chlamydias, and spirochetes, but is found in most other complete genomes to date. The homolog form Synechocystis sp. is fused to a MobA-homologous region and is an outlier to all other bacterial forms by both neighbor-joining and UPGMA analyses. Members of this family are well-conserved. The seed for this model excludes both archaeal sequences and the most divergent bacterial sequences, but still finds all candidate MoaC sequences easily between trusted and noise cutoffs. We suggest that sequences branching outside the set that contains all seed members be regarded only as putative functional equivalents of MoaC unless and until a member of the archaeal outgroup is shown to have equivalent function. [Biosynthesis of cofactors, prosthetic groups, and carriers, Molybdopterin]
Statistics
?
PSSM-Id: 129670
View PSSM: TIGR00581
Aligned: 10 rows
Threshold Bit Score: 185.328
Threshold Setting Gi: 5105030
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EKR_A         4 LTHINAAGeAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSK 83  Escherichia coli
BAA80344       5 GCCCVLSG-AGMVDITAKEPVRREAVASGFISLKRETVKAIREGRVEKGDVISVASVAAVLAVKETPRLIPLTHPIPIEK 83  Aeropyrum perni...
O66810         1 ---------MRTVDITTKIETLREAKAYGRIRLKPETVKLIKENKVPKGNLVEATKLSGIFGAKKTGELLPFCHPIPLDF 71  Aquifex aeolicu...
O05788         8 LTHIDERGaARMVDVSEKPVTLRVAKASGLVIMKPSTLRMISDGAAAKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDA 87  Mycobacterium t...
CAA17096       8 LTHLDEQGaARMVDVSAKAVTLRRARASGAVLMKPSTLDMICHGTAAKGDVIATARIAGIMAAKRTGELIPLCHPLGIEA 87  Mycobacterium t...
P45310         4 FTHINSQGeANMVDVSAKAETVREARAEAIVTMSKETLSMIVEGKHHKGDVFATARIAGIQAAKRTWELIPLCHPLLLSK 83  Haemophilus inf...
O53876        15 LSHQDERGaAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTG 94  Mycobacterium t...
WP_001516031  15 LTHINAAGeAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSK 94  Escherichia
O05520         4 FSHFNEQGrAQMVDISEKSSTVRTAAAVSSVHMKNEVYEKIQSHDIGKGDVLAVAQVAGIMAAKQTSNIIPMCHPLSLSG 83  Bacillus subtil...
4FDF_A        15 LSHQDERGaAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTG 94  Mycobacterium t...
1EKR_A        84 VEVNLQAEp--eHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMViGPVRLLAKSGGKS 152 Escherichia coli
BAA80344      84 VEPEVRVR----DDGVEVRVRVATTAKTGVEMEALAGVTAALLTVWDMVKSLEKDET-GNYPDTVITGVKV 149 Aeropyrum pernix K1
O66810        72 VALEVKVN----EDNLEVFSTVRGIARTGYEMEALTAVTTALLNVYDMCKALDDSMViEEVKLLEKSGGKS 138 Aquifex aeolicus VF5
O05788        88 VSVTITPCe---PDRVKILATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEiSQIVLQEKSGGRS 155 Mycobacterium tuberculosis
CAA17096      88 VTVTLEPQg---ADRLSIAATVTTVARTGVEMEALTAVTVTALTVYDMCKAVDRAMTiTDIRLDEKSGGRS 155 Mycobacterium tuberculos...
P45310        84 VEVNLEPLl--eTNQVRIQSLCKLTGKTGVEMEALTAASVAALTIYDMCKAVQKDIViEHVRLLEKSGGKS 152 Haemophilus influenzae R...
O53876        95 VDVDFTVG----QLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALiDDIRVLHKEGGRR 161 Mycobacterium tuberculosis
WP_001516031  95 VEVNLQAEp--eHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMViGPVRLLAKSGGKS 163 Escherichia
O05520        84 VDISFDWKikeaEVILHIKAQVKTKGSTGVEMEALTSASVCALTVYDMCKALDKGMViGPTFLLEKTGGKN 154 Bacillus subtilis subsp....
4FDF_A        95 VDVDFTVg----QLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALiDDIRVLHKEGGRR 161 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap