Conserved Protein Domain Family
dnaq

?
TIGR00573: dnaq 
exonuclease, DNA polymerase III, epsilon subunit family
All proteins in this family for which functions are known are components of the DNA polymerase III complex (epsilon subunit). There is, however, an outgroup that includes paralogs in some gamma-proteobacteria and the n-terminal region of DinG from some low GC gram positive bacteria. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, Degradation of DNA]
Statistics
?
PSSM-Id: 129663
View PSSM: TIGR00573
Aligned: 6 rows
Threshold Bit Score: 238.504
Threshold Setting Gi: 499180932
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P13267        413 HRLLEEETYVVFDVETTGLSAVYD-TIIELAAVKVKGGEIIDKFEAFANPHRPLSATIIELTGITDDMLQDAPDVVDVIR 491  Bacillus subt...
P03007          6 TRQIVLDTETTGMNQIGAHYEGHK-IIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVAD 84   Escherichia c...
P43745          5 NRQIVLDTETTGMNQLGAHYEGHC-IIEIGAVELINRRYTGNNXHIYIKPDRPXDPDAIKVHGITDEMLADKPEFKEVAQ 83   Haemophilus i...
Q08880          5 QRIIVLDTETTGMNSVGPPYLNHR-IIEIGAIEIINRRFTGKKFHTYIKPNRLIESDASKIHGITDDFLSDKPSFKDIAK 83   Buchnera aphi...
O83649          7 FAVHEHVAFTAFDTETTGLKAEEDrIIEIGAVT-FDRKGIIARFSTLIFPDRAIPPDVSKINHITDDMLVNKPRFCEIVS 85   Treponema pal...
WP_010878472    2 EGSLRKVQFLSIDLETTGLNQKKDeIIAIGAVPIIGTRILAGESYYRLLRPEKFKHESMKFHGLDPARLKTAHDFSEIAE 81   Archaeoglobus...
P13267        492 DFREWIGDDILVAHNASFDMGFLNVAYKKL-LEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKKFDIELTQHHRAIYD 570  Bacillus subt...
P03007         85 EFMDYIRGAELVIHNAAFDIGFMDYEFSLL-KRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG 163  Escherichia c...
P43745         84 DFLDYINGAELLIHNAPFDVGFMDYEFRKL-NLN-VKTDDICLVTDTLQMARQMYPGKRNNLDALCDRLGIDNSKRTLHG 161  Haemophilus i...
Q08880         84 DFFNYIKNSELIIHNASFDVGFINQEFSML-TKKIQDISNFCNIIDTLKIARKLFPGKKNTLDALCMRYKIKNSHRVLHG 162  Buchnera aphi...
O83649         86 DFSRFIKGTVLVAHNANFDVEFLNAELS-L-CKKQPLSHKVVDTYAMAQAVFPGLGRHQYRLQNLALQFGLTVH--AAHR 161  Treponema pal...
WP_010878472   82 EVADLLRGKVLVGYAIELDYGFLKRALKREgYKVENKRIDVIDFEKAVCYILGERPVGEMTLDNLAKKYRVEVS--YRHN 159  Archaeoglobus...
P13267        571 TEATAYLLLKMLKDAAEKGIQYHdelnENMGqsnayQRSRPYHATLLAVNSTGLKNLFKLVSLSHIHY 638  Bacillus subtilis subsp. ...
P03007        164 ALLDAQILAEVYLAMTGGQTSMAf---AMEGe---tQQQQGEATIQRIVRQASKLRVVFATDEEIAAH 225  Escherichia coli K-12
P43745        162 ALLDAEILADVYLMMTGGQTNLFdeeeSVESgvirvMQEKTAEEIKSAVDFSHNLKLLQPTNDELQAH 229  Haemophilus influenzae Rd...
Q08880        163 AILDAFLLGKLYLLMTSGQESIIf--nKNIQ-----NERNFRYIKKSITKKHRFLKIIKANKTELKLH 223  Buchnera aphidicola str. ...
O83649        162 AEDDARVCMELFTTMIAHHAKQN-------G-------HCVNHAQSPTIKK--LIQEIQASSTDCSQE 213  Treponema pallidum subsp....
WP_010878472  160 ALADAFITAQIFQVQLLKILKYG------------------------IKTIDMLFDLIKRVERDRQYH 203  Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap