Conserved Protein Domain Family
cdk7

?
TIGR00570: cdk7 
CDK-activating kinase assembly factor MAT1
All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129661
View PSSM: TIGR00570
Aligned: 6 rows
Threshold Bit Score: 431.921
Threshold Setting Gi: 927727
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC25575   1 MDDQ-----ACPRCKTTKYRNPSLKLMVN-VCGHTLCESCVDLLFLKGSGACP--ECMVPLRRNNFRVQLFEDPMVEKEV 72  fruit fly
P51948     1 MDDQ-----GCPRCKTTKYRNPSLKLMVN-VCGHTLCESCVDLLFVRGAGNCP--ECGTPLRKSNFRVQLFEDPTVDKEV 72  human
AAA91741   1 MDDQ-----GCPRCKTTKYRNPSLKLMVN-VCGHTLCESCVDLLFVRGAGNCP--ECGTPLRKSNFRVQLFEDPTVDKEV 72  house mouse
P51951     1 MDDQ-----GCPRCKTTKYRNPSLKLMVN-VCGHTLCESCVELLFVRGSGSCQ--ECDTPLRKSNFKVQLFEDPTIDKEV 72  African clawed frog
P51950     2 MEEQ-----ACPRCKSTKYRNPSLKLLVN-VCGHTLCENCVEILFVRGSGSCP--SCNTPLRRNQFRVQEFEDAYVEKEV 73  spiny starfish
AAB64899   3 MDEYeenkdMCPICKTDRYLSPDVKFLVNpECYHRICESCVDRIFSLGPAQCPykGCDKILRKNKFKTQIFDDVEVEKEV 82  baker's yeast
AAC25575  73 DIRRRILRDYNKREEDFA-SLAEYNDYLEEIEDIVYNLCNNIDIIETNKRIEAYKRDNREVIQRNKTRVGRDEYALEEML 151 fruit fly
P51948    73 EIRKKVLKIYNKREEDFP-SLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEAL 151 human
AAA91741  73 EIRKKVLKIYNKREEDFP-SLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQKNKLKLTREQEELEEAL 151 house mouse
P51951    73 EIRKKILKIYNKREEDFP-SLREYNDFLEEIEEIVLNLTNNVDLDNTRRKIDMYQKENKDTIQRNKIKMTREQEELEEAL 151 African clawed frog
P51950    74 DIRKRILKDFNKQEEEFP-ALKDYNDYLEEIETIIFNLANGTELEATKRKVDQYRKNNRESIMKNRSKQSSDQAYLEALL 152 spiny starfish
AAB64899  83 DIRKRVFNVFNKTIDDFNgDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQ 162 baker's yeast
AAC25575 152 ELEKVQEEARRKELEELENEHKKKKARDKQALIEELMYSGKDAAQIVTEFAEKAEKQREEEKQLPPPKPAnEFSTGIKFg 231 fruit fly
P51948   152 EVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPV-TFSTGIKM- 229 human
AAA91741 152 EVERQEHEQRQLFIQKEEELQQALKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPRSMKPV-TFSTGIKM- 229 house mouse
P51951   152 EMEKHENEQRRLHLQKEEQFQQMMKRKNKQELLDQLETSHLPASILLAQHKGKSVQAEMQVEKPRSFKTD-TFSTGIKK- 229 African clawed frog
P51950   153 QQENEDEEEKKQQLQFMERQTKNQKKRDKEALIDELIHSNMPADHVIASHTANVEMQEAPVFKLP--KKT-TFSTGIKVg 229 spiny starfish
AAB64899 163 KFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLSTTTQDINETIEG-VKNTVKLKKSSARRKLEELNrVLKNN---- 237 baker's yeast
AAC25575 232 qTADPSLLPVPKSEEgPLFVYEPLVPFSEGPAMPPTNEIVSRGYIAHIRAETPQENAGGFTSALACERALQEALQGLYYT 311 fruit fly
P51948   230 -GQHISLAPIHKLEE-ALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQ 307 human
AAA91741 230 -GQQISLAPIQKLEE-ALYEYQPLQIETCGPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQ 307 house mouse
P51951   230 -GHHIASVPVTKIEE-ALYQYQPIHIETYGPQVPHIEMLGRQGYLNHVRAAAPQDLAGGYVSSLACHRALQDAFSGLFWQ 307 African clawed frog
P51950   230 fGYQDTFLPIPKQEE-ILFTYEEETYETYGPSAPSTDELDTQRYNKHVRPASPQGIAGGYSQNLACLRALQEAFSGLLYF 308 spiny starfish
AAB64899 238 -PYFNSNVNVQNSRLkDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNYAYERVLTEAFMGLGCV 316 baker's yeast
AAC25575 312 AT 313 fruit fly
P51948   308 PS 309 human
AAA91741 308 PR 309 house mouse
P51951   308 TH 309 African clawed frog
P51950   309 PS 310 spiny starfish
AAB64899 317 IS 318 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap