1KXU


Conserved Protein Domain Family
ccl1

?
TIGR00569: ccl1 
Click on image for an interactive view with Cn3D
cyclin ccl1
All proteins in this family for which functions are known are cyclins that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, StanfordUniversity). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129660
View PSSM: TIGR00569
Aligned: 6 rows
Threshold Bit Score: 385.727
Threshold Setting Gi: 543985
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KXU_A    12 YHNSSQKRHWTFSsEEQLARLRADANR-----------KFRCKA---VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEF 77  human
P51946     2 YHNSSQKRHWTFSsEEQLARLRADANR-----------KFRCKA---VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEF 67  human
P51947     2 YHNSTQKKHWTFLsEDEPLRRRIQANV-----------RYRARI---RATEKPRLSEIFSLEPHEELAICKYYEKRLLDF 67  African clawed frog
AAC26868   2 YPVSSQKRSWTFAnEGQLMEFRVEQNS-----------KYIESH---EEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDF 67  fruit fly
P36613     6 FRDSTHYRDWIFT-EEDLSKTRAKVNEkftn----ivrERMLEElslQNKEASLEVLPPTLTVEEELELVNYYSFQLNAL 80  Schizosaccharomyces...
P37366    49 YRHSSQYRMWSYT-KDQLQEKRVDTNAraiayieenllKFREAHnltEEEIKVLEAKAIPLTMEEELDLVNFYAKKVQVI 127 Saccharomyces cerev...
1KXU_A    78 CSVFKpaMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESplgqekAlEQILEYE 157 human
P51946    68 CSVFKpaMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESplgqekAlEQILEYE 147 human
P51947    68 CNAFKptMPKSVLGTACMYFKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNVSSIQFVGNLGENplgqekIlEQILEYE 147 African clawed frog
AAC26868  68 CRRFEptMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDrn---kAtDIVLSNE 144 fruit fly
P36613    81 SSALS--LPTHIRSTAILFFKRFYLINSVMEYSPKIISFTSLFLATKCNDHYISIEQFCKNMPKT------TpEEVLEYE 152 Schizosaccharomyces...
P37366   128 AQHLN--LPTEVVATAISFFRRFFLENSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKST------R-DSVLKFE 198 Saccharomyces cerev...
1KXU_A   158 LLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTAD---DFLNRIALTDAYLLYTPSQIALTAILSSASRA 234 human
P51946   148 LLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTAD---DFLNRIALTDAYLLYTPSQIALTAILSSASRA 224 human
P51947   148 LLLIQQLNFHLIVHNPYRPFEGFLIDVKTRYPMLENPEVLRKSAD---EFLNRVALTDACLLFAPSVIALTAILSTASRA 224 African clawed frog
AAC26868 145 LLLIGQLNYYLTIHNPFRPIEGFLIDIKTRS-NMQNPDRLRPHID---SFIDSTYYSDACLLHTPSQIALAAVLHAASRE 220 fruit fly
P36613   153 FNVCQSLKWDLYVWLPFRPLQGFLLDCQTVLPKVAVEKFYECHDLs-kKFLIETLHSDIYFLHSPSIIALGAIYHTNPTI 231 Schizosaccharomyces...
P37366   199 FKLLESLKFSLLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDrckKRITAALLTDVVYFYTPPQITLATLLIEDEAL 278 Saccharomyces cerev...
1KXU_A   235 GI-----TMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALN-------VITK 302 human
P51946   225 GI-----TMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALN-------VITK 292 human
P51947   225 GL-----NMESYLTECLSLKDNQETMSHLLDGMRRLKILVSKYEPARPEEVAALKKRLDHCHSTEVTLS-------VHGR 292 African clawed frog
AAC26868 221 QE-----NLDSYVTDLLFVS-AREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDse----lYKER 290 fruit fly
P36613   232 CL---------QYIEAKKIP---ELQPLIISISANLKATKKFKIEK--KKAQDYGRKLYFCMNPLRNKSs------ALYL 291 Schizosaccharomyces...
P37366   279 VTryletKFPSREGSQESVPGNEKEEPQNDASTTEKNKEKSTESEEYSIDSAKLLTIIRECKSIIEDCKppsteeaKKIA 358 Saccharomyces cerev...
1KXU_A   303 KRKGYED--DDYVSKKSK 318 human
P51946   293 KRKGYED--DDYVSKKSK 308 human
P51947   293 KRKGYED--DGYISKKPK 308 African clawed frog
AAC26868 291 LRRLYTDe-DDMPAEDAS 307 fruit fly
P36613   292 KRKAEEE--STNNNKWAK 307 Schizosaccharomyces pombe 972h-
P37366   359 AKNYYCQnpSTLIQKLKR 376 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap