2FD8


Conserved Protein Domain Family
alkb

?
TIGR00568: alkb 
Click on image for an interactive view with Cn3D
DNA alkylation damage repair protein AlkB
Proteins in this family have an as of yet undetermined function in the repair of alkylation damage to DNA. Alignment and family designation based on phylogenomic analysis of Jonathan A. Eisen (PhD Thesis, Stanford University, 1999). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129659
View PSSM: TIGR00568
Aligned: 5 rows
Threshold Bit Score: 268.635
Threshold Setting Gi: 2055386
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FD8_A    11 ILRRFAFNAAEQLIRDINDVASQSP-------------------FRQMVTPGGy----------TMSVAMTNCGHLGWTT 61  Escherichia coli K-12
P05050    21 ILRRFAFNAAEQLIRDINDVASQSP-------------------FRQMVTPGGy----------TMSVAMTNCGHLGWTT 71  Escherichia coli K-12
AAC45302   1 MARPAGYSAQRALVEAVLAGAEQAP-------------------FSNYRTAYGk----------PMSVAMTALGSLGWTS 51  Caulobacter crescen...
CAA63047  44 LKLYSQKPNVCNLDTHMSKEETQDL-------------------WEQSKEFLRyk-------eaTKRRPRSLLEKLRWVT 97  human
CAA18657  60 LKNYVSSELQMQLLKSIMFTQIQDPenktnlspfyqlplgndsiWRRYYNGDGesiidglgetkPLTVDRLVHKKLRWVT 139 fission yeast
2FD8_A    62 HRQGYLYSPIDPQTNKPWPAMPQSFHNLCQ-RAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL 140 Escherichia coli K-12
P05050    72 HRQGYLYSPIDPQTNKPWPAMPQSFHNLCQ-RAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGL 150 Escherichia coli K-12
AAC45302  52 DARGYRYVDRHPETGRPWPDMPPALLDL-----WTVLGDPETPPDSCLVNLYATGARMGLHQDRDEADPRFPLLSISLGD 126 Caulobacter crescen...
CAA63047  98 VGYHYNWDSKKYSADHYTP-FPSDLGFLSe-QVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQ 175 human
CAA18657 140 LGEQYDWTTKEYPDPSKSPGFPKDLGDFVEkVVKESTDFLHWKAEAAIVNFYSPGDTLSAHIDESEEDLTLPLISLSMGL 219 fission yeast
2FD8_A   141 PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGI 179 Escherichia coli K-12
P05050   151 PAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGI 189 Escherichia coli K-12
AAC45302 127 TAVFRIGGVNRKDPTRSLRLASGDVCRLLGPARLAFHGV 165 Caulobacter crescentus CB15
CAA63047 176 SAIFLLGGLQRDEAPPPMFMHSGDIMIMSGFSRLLNHAV 214 human
CAA18657 220 DCIYLIGTESRSEKPSALRLHSGDVVIMTGTSRKAFHGK 258 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap