Conserved Protein Domain Family
lolB

?
TIGR00548: lolB 
outer membrane lipoprotein LolB
This protein, LolB, is known so far only in the gamma and beta subdivisions of the Proteobacteria. It is a processed, lipid-modified outer membrane protein. It is required in E. coli for insertion of the major outer lipoprotein (Lpp) into the outer membrane. Lpp is transferred to LolB from the carrier protein LolA in the periplasm. Previously, this protein was thought to play in role in 5-aminolevulinic acid synthesis and was designated HemM. [Protein fate, Protein and peptide secretion and trafficking]
Statistics
?
PSSM-Id: 129639
View PSSM: TIGR00548
Aligned: 3 rows
Threshold Bit Score: 281.091
Threshold Setting Gi: 557258
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P24208     5 DFRLIRLLpLAALVLTACSVTTPKGPGKS---PDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRY 81  Escherichia coli
P45270     6 TFKFFTAL-FATAILTACTLDMERPTNVQyidKTDAIWQQHLQKIQKIQSYQAKGQIGYISPTERFSSRFEWQYQNPKSY 84  Haemophilus influen...
CAA57571   2 RLRLFLAA-SALALLSGCAGLTSHEALEGq--GDAQTWKTHKQQLSELDAWQIDGKVGIRAPRDSGSGTLFWLQR-QGYY 77  Pseudomonas aerugin...
P24208    82 RLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEIT 161 Escherichia coli
P45270    85 TLKLYSLISKSTLWIQMHQSGMTISDNNGNQQSAANSKLLLQEIIGMDVPLEHLAYWLKGQPAMNADYQVGTNHLLGAFT 164 Haemophilus influen...
CAA57571  78 DIRLSGPLGRGAARLTGREGAVSLEVAGQGRYQAESPESTAGRTLGWRLPVSHLLWWVRGLPAPDSKSRLTLDADSRLAR 157 Pseudomonas aerugin...
P24208   162 YSQNGKNWKVVYGGYDTKTQpaMPANMELTD--GGQRIKLKMDNWIV 206 Escherichia coli
P45270   165 YHVDGSQWTADYLTYHSNNS--MPENILLKNdsTKQTLKIRVDEWIY 209 Haemophilus influenzae Rd KW20
CAA57571 158 LEQDG--WQIEYTRYAEQNGywLPERLKLHG--QDLDVTLVIKDWQP 200 Pseudomonas aeruginosa PAO1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap