3A7A


Conserved Protein Domain Family
lipoyltrans

?
TIGR00545: lipoyltrans 
Click on image for an interactive view with Cn3D
lipoyltransferase and lipoate-protein ligase
One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 161920
View PSSM: TIGR00545
Aligned: 6 rows
Threshold Bit Score: 404.587
Threshold Setting Gi: 239938657
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3A7A_A         3 L-R-LLISDSYDPWFNLAVEECIFRQMPATQR-----VLFLWRNADTVVIGRAQNPWKECNTRRMEEDNVRLARRSSGGG 75  Escherichia col...
P75394         3 T-Y-ILTSPKNIPYFNAALEEWLLTEFKKGEEi---kVIYFWQNANTIVVGRNQNTYAEVNLSEVEKDKVNLFRRFSGGG 77  Mycoplasma pneu...
P47051       115 G-RfVIQSLSTSPYYNLALENYVFKNTPRAKRgpdncRLLFYINDRCAVIGKNQNLWQEVDLAKLKSKNFELLRRFSGGG 193 Saccharomyces c...
WP_000105884   3 TlR-LLISDSYDPWFNLAVEECIFRQMPATQR-----VLFLWRNADTVVIGRAQNPWKECNTRRMEEDNVRLARRSSGGG 76  Escherichia coli
WP_003244914   2 L-F-IDNQNINDPRINLAIEEYCVKHLDPEQq-----YLLFYVNQPSIIIGKNQNTIEEINTKYVEENGIIVVRRLSGGG 74  Bacillus subtilis
P47512         3 T-F-IITSPVFNPYFNAALEEWLLTEFRKNELv---kVIYFWQNANTIVVGRNQNTYAEVNLKELESDKVNLFRRFSGGG 77  Mycoplasma geni...
3A7A_A        76 AVFHDLGNTCFTFMAGK--PEYDK--TISTSIVLNALNALGVSAEASG--RNDLVVKtvegDRKVSGSAYRETKDRGFHH 149 Escherichia col...
P75394        78 AVFHDMGNICFSIILPKakKEMENayEETTRNVVKFLNSVGVPAQFHG--RNDLEIE----GKKFSGLAEYLSKDRVLVH 151 Mycoplasma pneu...
P47051       194 TVLHDLGNVNYSYLTSR--EKFET--KFFNKMIIKWLNSLNPELRLDLneRGDIIQD----GFKISGSAYKIAGGKAYHH 265 Saccharomyces c...
WP_000105884  77 AVFHDLGNTCFTFMAGK--PEYDK--TISTSIVLNALNALGVSAEASG--RNDLVVKtvegDRKVSGSAYRETKDRGFHH 150 Escherichia coli
WP_003244914  75 AVYHDLGNLNFSFITKDdgDSFHNf-KKFTEPVIQALHQLGVEAELSG--RNDIVVD----GRKISGNAQFATKGRIFSH 147 Bacillus subtilis
P47512        78 AVFHDLGNICFSIILPRtgKVMENayEQTTRNVVKFLNSLNVPAVFHG--RNDLEIN----NKKFSGLAEYIAKDRLLVH 151 Mycoplasma geni...
3A7A_A       150 GTLLLNADLSRLANYLN---PDKKKLAAKGITSVRSRVTNLTELLPG-ITHEQVCEAITEa-FFAhYGERVEAEIISPNK 224 Escherichia col...
P75394       152 GTLLFDTDFTKLAKYLN---VDKTKMVSKGIESVQKRVVNVKEYLPN-LSTPTFLEKMVQ--FFT-ETEHAETIHLDESS 224 Mycoplasma pneu...
P47051       266 ATMLLNADLEQFSGLLEpslPNNMEWESSGVHSVKSKIKNVGIITPN--QFIAVVSERFQktFKV--DGEIPIYYCDEFK 341 Saccharomyces c...
WP_000105884 151 GTLLLNADLSRLANYLN---PDKKKLAAKGITSVRSRVTNLTELLPG-ITHEQVCEAITEa-FFAhYGERVEAEIISPNK 225 Escherichia coli
WP_003244914 148 GTLMFDSAIDHVVSALK---VKKDKIESKGIKSIRSRVANISEFLDDkMTTEEFRSHLLRhiFNTnDVGNVPEYKLTEKD 224 Bacillus subtilis
P47512       152 GTLLFDTDFSKLAKYLN---VDKTKIASKGVDSVAKRVVNVKEYLPN-WTTAKFLEEMIN--FFT-VTEKAETIVLTKDA 224 Mycoplasma geni...
3A7A_A       225 TPDLPNFAEtfARQSSWEWNFGQAPAFSHLLDERFT-WGGVELHFDVEKGHITRAQVFTDSLNPAPLEALAGRLQGCLYR 303 Escherichia col...
P75394       225 IKMVEKRAQ--EHFQSWDWNFGKTADYNFKNKKRFEgAGIFECNVQVDQGKVVDIKFYGDFLSVIDITPVTQQLVGQKYD 302 Mycoplasma pneu...
P47051       342 SINDEIKDAm-NTLQSEQWKYFSGPKFSVKIKD-------KGLTIKVEKGMIYDCD--------------RNDLIGLEFK 399 Saccharomyces c...
WP_000105884 226 TPDLPNFAEtfARQSSWEWNFGQAPAFSHLLDERFT-WGGVELHFDVEKGHITRAQVFTDSLNPAPLEALAGRLQGCLYR 304 Escherichia coli
WP_003244914 225 WETIHQISK--ERYQNWDWNYGRSPKFNLNHSKRYP-VGSIDLHLEVKKGKIEDCKIFGDFFGVGDVSEIENLLVGKQYE 301 Bacillus subtilis
P47512       225 LAKVEKRAK--EHFQSWEWNFGKTYEYNFKNKRYFNnAGLFECNVQVEKGTVVDIKFYGDFLSVVDITPVTKKLIGQKYD 302 Mycoplasma geni...
3A7A_A       304 ADMLQQECEALLVdFPEQEKELRELS 329 Escherichia coli K-12
P75394       303 YQTFAKILGNIDN-FKEYFGTLTPQQ 327 Mycoplasma pneumoniae M129
P47051       400 G-----FLENIDS-YT---------- 409 Saccharomyces cerevisiae S288c
WP_000105884 305 ADMLQQECEALLVdFPEQEKELRELS 330 Escherichia coli
WP_003244914 302 RSVIADVLEGVN--LKHYFGNITKED 325 Bacillus subtilis
P47512       303 YKTFEKLFNELDH-FSDYFGSLKPEQ 327 Mycoplasma genitalium G37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap