3CQI


Conserved Protein Domain Family
hxl6Piso_put

?
TIGR00542: hxl6Piso_put 
Click on image for an interactive view with Cn3D
hexulose-6-phosphate isomerase, putative
This family shows similarity by PSI-BLAST to other isomerases. Putative identification as hexulose-6-phosphate isomerase is reported in Swiss-Prot, attributing a discussion in Genome Sci. Technol. 1:53-75(1996). This family is conserved at better than 40 % identity among the four known examples from three species: Escherichia coli (SgbU and SgaU), Haemophilus influenzae, and Mycoplasma pneumoniae. The rarity of the family, high level of conservation, and proposed catabolic role suggests lateral transfer may be a part of the evolutionary history of this protein. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129633
View PSSM: TIGR00542
Aligned: 5 rows
Threshold Bit Score: 498.606
Threshold Setting Gi: 2498908
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CQI_A        15 KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDERLSRLDWSREQRLALVNAIVETGVRVPSMCLSAHRRFP 94  Escherichia coli
P39305         4 KQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDDRLSRLNWSREQRLALVNAIVETGVRVPSMCLSAHRRFP 83  Escherichia col...
P75294        21 NKHLLGVYEKAINNKFAWKDKIAIAKQASFDFIELSIDESDARLQRLDWSDTEINQLHNELQAQTFCLNSMCLSAHRRFP 100 Mycoplasma pneu...
WP_001350555   2 RNHQLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLDWSAAQRTSLVAAMIETGVGIPSMCLSAHRRFP 81  Escherichia coli
P44990         2 KKHKIGIYEKALPKNITWQERLSLAKACGFEFIEMSIDESNDRLSRLNWTKSERIALHQSIIQSGITIPSMCLSAHRRFP 81  Haemophilus inf...
3CQI_A        95 LGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMN 174 Escherichia coli
P39305        84 LGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMS 163 Escherichia col...
P75294       101 LGSKNKTTVQQGLTIFEKACVLARKLGIRIIQLAAYDVYYEPHDTETERNFITNMRKVAELAQKYAVTIAFEVMDTPFAG 180 Mycoplasma pneu...
WP_001350555  82 FGSRDEAVRERAREIMSKAIRLARDLGIRTIQLAGYDVYYEDHDEGTRQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMN 161 Escherichia coli
P44990        82 FGSKDKKIRQKSFEIMEKAIDLSVNLGIRTIQLAGYDVYYEKQDEETIKYFQEGIEFAVTLAASAQVTLAVEIMDTPFMS 161 Haemophilus inf...
3CQI_A       175 SISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKP------GVFKNVPFGEGVVDFERCFE 248 Escherichia coli
P39305       164 SISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKP------GVFKNVPFGEGVVDFERCFE 237 Escherichia col...
P75294       181 TIVRCLNLIKRIGKANILLYPDIGNLSQFSTAVFDEIALGQDKIVGFHFKDTLP------KQFKEVPFGTGTAQFEAALK 254 Mycoplasma pneu...
WP_001350555 162 SISKWKKWDEMLASPWFTVYPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPvtgqspGQFRDVPFGEGCVDFVGIFK 241 Escherichia coli
P44990       162 SISRWKKWDTIINSPWFTVYPDIGNLSAWNNNIEEELTLGIDKISAIHLKDTYPvtetskGQFRDVPFGQGCVDFVHFFS 241 Haemophilus inf...
3CQI_A       249 TLKQSGYCGPYLIEMWSET--AE---DPAAEVAKARDWVKARMAKAGMVE 293 Escherichia coli
P39305       238 TLKQSGYCGPYLIEMWSET--AE---DPAAEVAKARDWVKARMAKAGMVE 282 Escherichia coli K-12
P75294       255 AIHQYVPTVPILIEMWSKNdpAEstvQNVAQLKQAKQFYEQQWDLALKRV 304 Mycoplasma pneumoniae M129
WP_001350555 242 TLHKLNYRGSFLIEMWTEK--AK---EPVLEIIQARRWIEARMQEAGFIC 286 Escherichia coli
P44990       242 LLKKLNYRGAFLIEMWTEK--NE---EPLLEIIQARKWIVQQMEKAGLLC 286 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap