Conserved Protein Domain Family
hisDCase_pyru

?
TIGR00541: hisDCase_pyru 
histidine decarboxylase, pyruvoyl type
This enzyme converts histadine to histamine in a single step by catalyzing the release of CO2. This type is synthesized as an inactive single chain precursor, then cleaved into two chains. The Ser at the new N-terminus at the cleavage site is converted to a pyruvoyl group essential for activity. This type of histidine decarboxylase appears is known so far only in some Gram-positive bacteria, where it may play a role in amino acid catabolism. There is also a pyridoxal phosphate type histidine decarboxylase, as found in human, where histamine is a biologically active amine. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129632
View PSSM: TIGR00541
Aligned: 2 rows
Threshold Bit Score: 610.865
Threshold Setting Gi: 124077297
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P00862     3 ELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTAS 82  Lactobacillus sp. 30A
AAA83526  18 HKNIKVRAPKIDKTAISPYDRYCDGYGMPGAYGNGYVSVLKVSVGTVKKTDDILLDGIVSYDRAEINDAYVGQINMLTAS 97  Clostridium perfrin...
P00862    83 SFTGVQGRVIGYDILR--SPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTA 160 Lactobacillus sp. 30A
AAA83526  98 SFCGVAGQVWGHDLAThdSIANDEIKPLYELKQFDGTPLKVYDAKPLLEAGIELFGTEKNRRFTTAPGAHVICANKSATA 177 Clostridium perfrin...
P00862   161 ERPKNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETP-NEDELLEYLEGRRKAMAKSIAECGQDAHASFES 239 Lactobacillus sp. 30A
AAA83526 178 YRPKENRPLKEGEAYGVWSFIALSLSNDRDHCADLFIEDAGLWTKNdNPEDLKKFLEDHRKAVTWSVVECGRDSHVVFER 257 Clostridium perfrin...
P00862   240 SWIGFAYTMMEPGQIGNAITVAPYVSLPIDSIPGgsiltpdKDMEIMENLTMPEWLEKMGYKSLSANNAL 309 Lactobacillus sp. 30A
AAA83526 258 TYIGFAYVIMKPGEIGNALTCAPYVTLARDAVPS-------EGFPSLNRISLSQWLDDMNFDSLVNPSKK 320 Clostridium perfringens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap