Conserved Protein Domain Family
hemN_rel

?
TIGR00539: hemN_rel 
putative oxygen-independent coproporphyrinogen III oxidase
Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins described by the model hemN. This model, hemN_rel, models a closely related protein, shorter at the amino end and lacking the region containing the motif PYRT[SC]YP found in members of the hemN family. Several species, including E. coli, Helicobacter pylori, Aquifex aeolicus, and Chlamydia trachomatis, have members of both this family and the E. coli hemN family. The member of this family from Bacillus subtilis was shown to complement an hemF/hemN double mutant of Salmonella typimurium and to prevent accumulation of coproporphyrinogen III under anaerobic conditions, but the exact role of this protein is still uncertain. It is found in a number of species that do not synthesize heme de novo. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129630
View PSSM: TIGR00539
Aligned: 3 rows
Threshold Bit Score: 537.184
Threshold Setting Gi: 487788873
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43899         7 LSLYIHIPWCVQKCPYCDFNSHAQKSdIPEQDYIYHLLQDLQADLQRFKdsiqQRKLHSIFIGGGTPSLFSAESIAYLLK 86  Haemophilus inf...
BAA12461       2 KSAYIHIPFCEHICHYCDFNKYFIQS-QPVDEYLNALEQEMINTIAKTG----QPDLKTIFIGGGTPTSLSEEQLKKLMD 76  Bacillus subtilis
WP_001862412   1 MILYIHIPFCENKCGYCAFNSYENKH-GLKEEYTQALCLDLKHALSQTD-----EPIESVFIGGGTPNTLSVKAFERIFE 74  Helicobacter py...
P43899        87 EIKKQID-FEDNIEITLEANPGTVEAERFKGYVSAGIMRISMGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKSFN 165 Haemophilus inf...
BAA12461      77 MINRVLKpSSDLSEFAVDANPDDLSAEKLKILKEAGVNRLSFGVQTFEDDLLEKIGRVHKQKDVFTSFERAREIGFENIS 156 Bacillus subtilis
WP_001862412  75 SIYQHAS-LSLDCEITTEANPELITKAWCQGLKGLGINRLSLGVQSFREDKLLFLERQHS-KNIAPAIETILKSGIENIS 152 Helicobacter py...
P43899       166 LDLMHGLPNQTLEEALDDLRQAIELSPPHISWYQLTIEPNTMFAYRPPK----LPDDDALWDIFEQGHQLLTMAGYQQYE 241 Haemophilus inf...
BAA12461     157 LDLMFGLPGQTLKHLEHSINTALSLDAEHYSVYSLIVEPKTVFYNLMQKgrlhLPPQEQEAEMYEIVMSKMEAHGIHQYE 236 Bacillus subtilis
WP_001862412 153 IDLIYNTPLDNENSLKEELKLAKELPINHLSAYALSVEKNTNLEKNAKK----P----SCAHFDNVVREILEGFSFKQYE 224 Helicobacter py...
P43899       242 TSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGEITRFSKTKHPKGYLRGEYLYEEKNVPKIDRPFEFFMNRFR 321 Haemophilus inf...
BAA12461     237 ISNFAKAGMESKHNLTYWSNEQYFGFGAGAHGYIGGTRTVNVGPVKHYIDLIAEKGFPYRDTHEVTTEEQIEEEMFLGLR 316 Bacillus subtilis
WP_001862412 225 VSNYARN-YQVKHNLAYWGAKDYLGCGAGAVGCVANERFFAKKLIENYIKDPLQRQVETLN-----KQDKRLEKLFLGLR 298 Helicobacter py...
P43899       322 LLEAVPKQEFEDYTGLSQSAVKNQIDFAIQQNYIVENADSWQITEHGKLF 371 Haemophilus influenzae Rd KW20
BAA12461     317 KTAGVSKKRFAEKYGRSLDGLFPSVLKDLAEKGLIHNSESAVYLTHQGNY 366 Bacillus subtilis
WP_001862412 299 CVLGVELSFLDENK----VKFLIEENKAFIKNNRLIASDFFMADEMALWL 344 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap