1OLT


Conserved Protein Domain Family
hemN

?
TIGR00538: hemN 
Click on image for an interactive view with Cn3D
oxygen-independent coproporphyrinogen III oxidase
This model represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions. Several species, including E. coli, Helicobacter pylori, and Aquifex aeolicus, have both a member of this family and a member of another, closely related family for which there is no evidence of coproporphyrinogen III oxidase activity. Members of this family have a perfectly conserved motif PYRT[SC]YP in a region N-terminal to the region of homology with the related uncharacterized protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]
Statistics
?
PSSM-Id: 129629
View PSSM: TIGR00538
Aligned: 5 rows
Threshold Bit Score: 806.704
Threshold Setting Gi: 3122198
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OLT_A         6 IDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVAR----YPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHK 81  Escherichia col...
O67886         3 AEFDKELIKKYDRPGPRYTSYPPATEFTEEVKEDEYVKRLIKs--nERKTPLSLYFHIPFCEQRCLYCGCNVIISHRKGI 80  Aquifex aeolicu...
O25376         2 QTIDFEKFSQYSKPGPRYTSYPTAVEFNENFNEESLKTAFFNhdnlKNPMPLSLYTHLPFCRSACYFCACSVIYTSLEEK 81  Helicobacter py...
WP_001701332   8 IDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVAR----YPERPLSLYVHIPFCHKLCYFCGCNKIVTRQQHK 83  Escherichia coli
P74132         8 VEFSAELLNKYNQGIPRYTSYPPATELNKEFDPSDFQTAINLg--nYKKTPLSLYCHIPFCAKACYFCGCNTIITQHKPA 85  Synechocystis s...
1OLT_A        82 ADQYLDALEQEIVHRAPLFAG-RHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ-FNADAEISIEVDPREIELDVLDHL 159 Escherichia col...
O67886        81 EEPYLERVCREMDLVSQYLDKdRKVIQLHWGGGTPNYLSPEQIKWFMEEIRKRFE-FGDNAEISIELDPRYLTDEQIKAI 159 Aquifex aeolicu...
O25376        82 KIRYISYLKKELALLKNAMDTnREVAQFHYGGGTPTFFSPIQLDEITQSIQEVFPnFSKDIEMSCEIDPRHFTKEHMQTL 161 Helicobacter py...
WP_001701332  84 ADQYLDALEQEIVHRAPLFAG-RHVSQLHWGGGTPTYLNKAQISRLMKLLRENFQ-FNADAEISIEVDPREIELDVLDHL 161 Escherichia coli
P74132        86 VDPYLKAVAKQIALVAPLVDQqRPVQQLHWGGGTPNYLTLEQAEFLFNTITDAFP-LAENAEISIEINPCYVDKDYIFAL 164 Synechocystis s...
1OLT_A       160 RAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSV 239 Escherichia col...
O67886       160 KDAGFNRISLGVQDLDPKVQQAVNRVQPYELIKEKMEKLREAGFESINLDLIYGLPYQTKESFEKTVEKVIELNPDRIAT 239 Aquifex aeolicu...
O25376       162 FDRGFNRLSFGVQDFDFEVQKAIHRIQPFEMVQESVKLARDYGIKSINFDLIYGLPNQTKEGFLKTLEWVLKLDPDRLAV 241 Helicobacter py...
WP_001701332 162 RAEGFNRLSMGVQDFNKEVQRLVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSV 241 Escherichia coli
P74132       165 RQLGFNRISFGIQDFNSQVQQAVNRIQPEAMLFQVMDWIRQANFDSVNVDLIYGLPHQNLATFRETLRKTAQLNPDRIAV 244 Synechocystis s...
1OLT_A       240 FNYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDT 319 Escherichia col...
O67886       240 YSFAYIPQVKPHQQLLPKEALPSAEEKLRIFEMVINKFQEAGYVYIGMDHFAKPEDELAVAQRKGELWRNFQGYTTKKGV 319 Aquifex aeolicu...
O25376       242 FNYAHVPWVKKTMRKIDETLLPSLRDKLEILESLISFLEKANYQMIGMDHFAKSDNELYLALQKAELRRNFQGYTTKKFT 321 Helicobacter py...
WP_001701332 242 FNYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVAQREGVLHRNFQGYTTQGDT 321 Escherichia coli
P74132       245 FNFAYVPWLKPVQKKMPESALPPAEEKLKIMQATIADLTEQGYVFIGMDHFAKPDDELAIAQRRGELHRNFQGYTTQPES 324 Synechocystis s...
1OLT_A       320 DLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYSPIEQQWDL----L 395 Escherichia col...
O67886       320 ELLGFGATSIGMLYDSYFQNWKTLRDYNKTVDEGKIPVFRGYVLNEDDFIRREVIMDIMCNLGVEFSKIENMFGI----N 395 Aquifex aeolicu...
O25376       322 QTIGIGVTSIGEGGDYYTQNYKDLHHYEKALDLGHLPVERGVALSQEDVLRKEVIMQMMSNLKLDYSKIEEKFSV----D 397 Helicobacter py...
WP_001701332 322 DLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRGIALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDL----H 397 Escherichia coli
P74132       325 DLLGFGITSISMLQDVYAQNHKTLKAFYNALDREVMPIEKGFKLSQDDLIRRTVIKELMCQFKLSAQELESKYNLgfdcD 404 Synechocystis s...
1OLT_A       396 FADYFAEDLKLLAPLAKDGLVDVDEKGIQVTAKGRLLIRNICMCFDTYLRQKaRMQQFSRVI 457 Escherichia coli ABU 83972
O67886       396 FREYFAKELEELKEMEEDGLIKVEEDRIKIMPVGRLLIRNVAMVFDAHLRRK-KELNFSRTI 456 Aquifex aeolicus VF5
O25376       398 FKAHFKKELEKLKPYEEAGLLSFNSKGFEMTKTGGMLVRNMAMEFDAYLRGG--EKHFSKTL 457 Helicobacter pylori 26695
WP_001701332 398 FADYFAEDLKLLAPLAKDGLVDVDEKGIQVTAKGRLLIRNICMCFDTYLRQKaRMQQFSRVI 459 Escherichia coli
P74132       405 FNDYFAKELSALDVLEADGLLRRLGDGLEVTPRGRILIRNIAAVFDTYLQNKsKQQMFSRAI 466 Synechocystis sp. PCC 6803 substr...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap