Conserved Protein Domain Family
hemK_rel_arch

?
TIGR00537: hemK_rel_arch 
HemK-related putative methylase
The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase. Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. This model represents an archaeal and eukaryotic protein family that lacks an N-terminal domain found in HemK and its eubacterial homologs. It is found in a single copy in the first six completed archaeal and eukaryotic genomes. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129628
View PSSM: TIGR00537
Aligned: 3 rows
Threshold Bit Score: 228.972
Threshold Setting Gi: 6226464
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58338        16 VYEPAEDS-ILLLKNLVDVKNKD-VLEIGVGTGLISIACAKKGAkKIVGVDINPYAVKLAKEnaklnnVNISFFESDLFE 93  Methanocaldococ...
O28490         2 IYEPAEDSeLLLEAALRELKPDDeVIEVGAGSGFVAERLKGKCK-CILTTDISPFAAMELRR------KGLDVVMTDIAK 74  Archaeoglobus f...
WP_010876942  17 VYEPAEDT-FLLADNLDVREGDR-VLEIGTGTGLVAIRASEKGD--VTATDVNPAAVKCTQEnaiingVELRVLQGDLFD 92  Methanothermoba...
Q58338        94 NVTG-KFDVILFNPPYLPTSEDEKIDSYLNFAFDGGKDGREILDRFIYELPNYLKKGGVVQILQSSLTgEKETINKLKPL 172 Methanocaldococ...
O28490        75 GIRK-KFSLVLFNPPYVELEDELRRGDWLDVAIDGGKKGVKVIKKFLDSLDEIMAERGRAILIASSQN-EPDVFDLIDER 152 Archaeoglobus f...
WP_010876942  93 PVEGeKFDVILFNTPYLPATGDDATGDVLDLAWNGGPDGRMVIDRFLDEVPAHLKPGGRVQLVQSSLSdTEKTLQKLADM 172 Methanothermoba...
Q58338       173 GFKVEISARLKVPFEELMVINAW 195 Methanocaldococcus jannaschii DSM 2661
O28490       153 GFRYEIVGERGLFFEKLFAIKIW 175 Archaeoglobus fulgidus DSM 4304
WP_010876942 173 GFDASVTASERYFFEEIVLITAM 195 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap