Conserved Protein Domain Family
HMG_CoA_R_NADP

?
TIGR00533: HMG_CoA_R_NADP 
3-hydroxy-3-methylglutaryl Coenzyme A reductase, hydroxymethylglutaryl-CoA reductase (NADP)
This model represents archaeal examples of the enzyme hydroxymethylglutaryl-CoA reductase (NADP) (EC 1.1.1.34) and the catalytic domain of eukaryotic examples, which also contain a hydrophobic N-terminal domain. This enzyme synthesizes mevalonate, a precursor of isopentenyl pyrophosphate (IPP), a building block for the synthesis of cholesterol, isoprenoids, and other molecules. A related hydroxymethylglutaryl-CoA reductase, typified by an example from Pseudomonas mevalonii, is NAD-dependent and catabolic. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 129624
View PSSM: TIGR00533
Aligned: 4 rows
Threshold Bit Score: 663.108
Threshold Setting Gi: 3929352
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P12684  612 MNN-TEVSNLVVNGKLPLYSLEKKLEdTTRAVLVRRKALSTLAEspiLVSEKLPFRNYDYDRVFGACCENVIGYMPIPVG 690  Saccharomyces cerev...
Q58116    1 MENyNDILEKMLNGEIKPYQLDKMFG-SKIATEIRRKFIEKKVG---IEFKHICNYSIDEEMAMKKNIENMIGAIQIPLG 76   Methanocaldococcus ...
O26662    1 MS----IMDDLMEGRIKLYEIERHVP-VDEAVRIRREFIERTCG---VKLEHVSNYSIDMERASRRNIENPIGVVQIPLG 72   Methanothermobacter...
P12683  616 LKN-KEVAALVIHGKLPLYALEKKLGdTTRAVAVRRKALSILAEapvLASDRLPYKNYDYDRVFGACCENVIGYMPLPVG 694  Saccharomyces cerev...
P12684  691 VIGPLIIDG----TSYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTLIRSGACKIWLDseEGQ 766  Saccharomyces cerev...
Q58116   77 FAGPLKINGeyakGEFYIPLATTEGALVASVNRGCSIITKCGGATVRVIDDKMTRAPCLKTKSVVDAIKVRDWIR--ENF 154  Methanocaldococcus ...
O26662   73 VAGPLRVRGehadGEYYVPLATSEGALVASVNRGCSVITRAGGATVRVTGDSMTRAPVIRTGSVVEALQLREWIY--ENM 150  Methanothermobacter...
P12683  695 VIGPLVIDG----TSYHIPMATTEGCLVASAMRGCKAINAGGGATTVLTKDGMTRGPVVRFPTLKRSGACKIWLDseEGQ 770  Saccharomyces cerev...
P12684  767 NSIKKAFNSTSRFARLQHIQ-TCLAGDLLFMRFRTTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEV--VSVSGNYCTD 843  Saccharomyces cerev...
Q58116  155 ERIKEVAESTTRHGKLIKIEpILIVGRNLYPRFVFKTGDAMGMNMVTIATEKACNFIEGELKKEGIFVktVAVSGNACVD 234  Methanocaldococcus ...
O26662  151 DALREEAESTTRHGKLVKIDpIIVAGSYVYPRFVYTTGDSMGMNMVTIATERALELLTRET---GAHV--IALSGNLCTD 225  Methanothermobacter...
P12683  771 NAIKKAFNSTSRFARLQHIQ-TCLAGDLLFMRFRTTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEV--VSVSGNYCTD 847  Saccharomyces cerev...
P12684  844 KKPAAINWIEGRGKSVVAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGgFNAHAANLVTALFLALGQDPAQ 923  Saccharomyces cerev...
Q58116  235 KKPSGMNLINGRGKSIVAEVFLTEKEVNKYLKTTSQAIAEVNRLKNYIGSAISNSMG-FNAHYANIIGAIFLATGQDEAH 313  Methanocaldococcus ...
O26662  226 KKPAAVNLIEGRGKSITAEITVPGEMVESVLKTTPEAVVEVNTAKNLIGSAAAGSMG-FNAHYANIIGAIFLATGQDEAH 304  Methanothermobacter...
P12683  848 KKPAAINWIEGRGKSVVAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGgFNAHAANLVTAVFLALGQDPAQ 927  Saccharomyces cerev...
P12684  924 NVESSNCITLMK-EVDGdLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGphptepGANARQLARIIACAVLAGELS 1002 Saccharomyces cerev...
Q58116  314 IVEGSLGITMAEvEDDG-LYFSVTLPDVPIGTVGGGTRVETQKECLEMLGCYG------DNKALKFAEIVGAAVLAGELS 386  Methanocaldococcus ...
O26662  305 IVEGSLGVTIAE-ERKGdLYFAVNLPDVPLATVGGGTGLETASECLDIMGVRG------GGRVHAFAEIVGGAVLAGELS 377  Methanothermobacter...
P12683  928 NVESSNCITLMK-EVDGdLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGphatapGTNARQLARIVACAVLAGELS 1006 Saccharomyces cerev...
P12684 1003 LCSALAAGHLVQSHMTHNR 1021 Saccharomyces cerevisiae S288c
Q58116  387 LLGALAAGHLGKAHQELGR 405  Methanocaldococcus jannaschii DSM 2661
O26662  378 LMGALAAGHLARAHSELGR 396  Methanothermobacter thermautotrophicus str. Delta H
P12683 1007 LCAALAAGHLVQSHMTHNR 1025 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap