Conserved Protein Domain Family
HMG_CoA_R_NAD

?
TIGR00532: HMG_CoA_R_NAD 
hydroxymethylglutaryl-CoA reductase, degradative
Most known examples of hydroxymethylglutaryl-CoA reductase are NADP-dependent (EC 1.1.1.34) from eukaryotes and archaea, involved in the biosynthesis of mevalonate from 3-hydroxy-3-methylglutaryl-CoA. This model, in contrast, is built from the two examples in completed genomes of sequences closely related to the degradative, NAD-dependent hydroxymethylglutaryl-CoA reductase of Pseudomonas mevalonii, a bacterium that can use mevalonate as its sole carbon source. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 129623
View PSSM: TIGR00532
Aligned: 2 rows
Threshold Bit Score: 613.578
Threshold Setting Gi: 3929353
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O28538  10 HYKSGKIRRAMSSRIPGfyKLSVEERLKKVAEFAGlsdEEVKAVLSQGLPLDVA-DrMIENVIGTFELPLGIATNFLIDG 88  Archaeoglobus fulgidu...
O51628   1 MNLESLSSFMELSKNFR--HKSVLEKRQEIKSFLE---LSYKDFFYNNANEDFLfN-MIENYIGYLSFPIGIVKNLKING 74  Borrelia burgdorferi B31
O28538  89 KDYLIPMAIEEPSVVAAASNAARMARESGGFTTDYTGSLMIgqiqVTKLLNPNAAKFEVLRQKDEIIERANECDPMLVNL 168 Archaeoglobus fulgidu...
O51628  75 KYYSLPIATEESSVVAALNFAAKILENADLRYSLGEVLGIS----QIYIKSEKDLSKIFVDLGDKIKTWIEPLLTNMNQR 150 Borrelia burgdorferi B31
O28538 169 GGGCKDIEARviDTIMGKMLIVHLIVDVKDAMGANAVNTMCEKVAPFIERITGGKVYLRIISNLAAYR--LARAKAVFDK 246 Archaeoglobus fulgidu...
O51628 151 GGGFRRLSTR--HIKELGIQKLNIYVDTCDAMGANLLNSIAERVAEFIFLEFGYECVLKVLSNDISEFtaKARFVLDFKH 228 Borrelia burgdorferi B31
O28538 247 DVIGGEE---VVEGIMLAYAFAAADPFRCATHNKGIMNGISALMIATGNDFRAIEAGAHSYAAIGG-YKPLTTYEvDRKG 322 Archaeoglobus fulgidu...
O51628 229 LLPGKEDswnLAKKIELISSIGFYEEERAVTNNKGIMNGITGVCLATFNDTRALEASVHKFASKSGkYFPLSKFY-TTDN 307 Borrelia burgdorferi B31
O28538 323 NLVGTIEIPMAVGVIGGATKVNPLAKISLKILGVNTAEELARVAAALGLAQNFAALRALATEGIQRGHMELHA 395 Archaeoglobus fulgidus DSM 4304
O51628 308 ALVGEIEIPLQVGTKGGVISFNEASILSFKIMNVNSKSEFIGILSCVGLASNFAALRALAFNGIQKGHMRLHV 380 Borrelia burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap