Conserved Protein Domain Family
AGP_acyltrn

?
TIGR00530: AGP_acyltrn 
1-acyl-sn-glycerol-3-phosphate acyltransferases
This model describes the core homologous region of a collection of related proteins, several of which are known to act as 1-acyl-sn-glycerol-3-phosphate acyltransferases (EC 2.3.1.51). Proteins scoring above the trusted cutoff are likely to have the same general activity. However, there is variation among characterized members as to whether the acyl group can be donated by acyl carrier protein or coenzyme A, and in the length and saturation of the donated acyl group. 1-acyl-sn-glycerol-3-phosphate acyltransferase is also called 1-AGP acyltransferase, lysophosphatidic acid acyltransferase, and LPA acyltransferase. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129621
View PSSM: TIGR00530
Aligned: 10 rows
Threshold Bit Score: 160.204
Threshold Setting Gi: 639651257
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P75479        70 GVKVVIVNPENVP-KKAVLVVANHKSNLDPLILIKAF-GktegvPPLTFIAKIELQDTWLFKIMKLID-CVFIDRKN-LR 145 Mycoplasma pneu...
P26647        50 GLKVECRKPTDAEsYGNAIYIANHQNNYDMVTASNIV-Q-----PPTVTVGKKSLLWIPFFGQLYWLTgNLLIDRNNrTK 123 Escherichia col...
P44848        50 GLKVEHRIPQDQKqISRAIYIGNHQNNYDMVTISYMV-Q-----PRTVSVGKKSLIWIPFFGILYWVTgNIFLDRENrTK 123 Haemophilus inf...
P33333        60 GLDVKVVGEENLA-KKPYIMIANHQSTLDIFMLGRIF-P-----PGCTVTAKKSLKYVPFLGWFMALSgTYFLDRSKrQE 132 Saccharomyces c...
O25903        54 GVNLEKIGTFDTD---AKLIVLNHQSLLDIIYLEAYH-P-----RNICWIAKKELGEIPFYGHALTDTgMILIDRED-KK 123 Helicobacter py...
Q59188        65 GIKIIVTGSENIPkKSNVIIMGNHIAAMDPLIFIYTF-A-----CPFVILAKHSLLRIPFVNIVLIVMgVIFVNRRS-IR 137 Borrelia burgdo...
Q49402        70 GIKVVTVNDKIIP-KKPVLVVANHKSNLDPLVLIKAF-GrlknsPPLTFVAKIELKDTVLFKLMKLID-CVFIDRKN-IR 145 Mycoplasma geni...
AAB41276      58 GLEVGRPAPEH-P--NGVLVAANHVSWLDIFAMSAVY-P-------SSFIAKQEIKSWPVLGKMGQNAgTVFINRNS-RR 125 Neisseria menin...
WP_010873224  41 lFQAQVYGQELVPtRGPALVVSNHASYFDPPFLSCAM-A-----RPVAFMAKEELFNVPLLGPAIRLYgAYPVKRGS--- 111 Synechocystis s...
WP_024712846  16 rggVKVYNKENLPaDSGFVIACTHSGWVDVITLGVGIlP-----YQIHYMAKKELFQNKWIGSFLKKIhAFPVDREN--- 87  Bacillus tequil...
P75479       146 QMAASLEQQQQIIRQGTALCVFPEGTRVLS--RQIGEFKSGALKVAYNAFVPIVPLTIV 202 Mycoplasma pneumoniae M129
P26647       124 AHGTIAEVVNHFKKRRISIWMFPEGTRSRG--RGLLPFKTGAFHAAIAAGVPIIPVCVS 180 Escherichia coli K-12
P44848       124 AHNTMSQLARRINEDNLSIWMFPEGTRNRG--RGLLPFKTGAFHAAISAGVPIIPVVCS 180 Haemophilus influenzae Rd KW20
P33333       133 AIDTLNKGLENVKKNKRALWVFPEGTRSYTseLTMLPFKKGAFHLAQQGKIPIVPVVVS 191 Saccharomyces cerevisiae S288c
O25903       124 GIVSLLKACKEKLDQNRPLVIFPEGTRGKGg-EKFLPFKQGAKIIAEKFQLKIQPMVLI 181 Helicobacter pylori 26695
Q59188       138 SAAAAEVKAIKVMREGRSIGIFPEGTRNRG--GDTRVFKKGSIKMALKTGTSILPVTLY 194 Borrelia burgdorferi B31
Q49402       146 QIANALETQQQLIRQGTAIAVFAEGTRILS--NDIGEFKPGALKVAYNAFVPILPVSIV 202 Mycoplasma genitalium G37
AAB41276     126 DIEPINRAVYETLQRGQNVSFFPEARTSSGlgLWISAFKAALFQSAIDAGAKVLAVALR 184 Neisseria meningitidis serogroup B
WP_010873224 112 GDRGALRAALTALGDGWLVGVFLEGTRTKD--GRIHQPKLGAAMIAAKAQVPIIPVSLG 168 Synechocystis sp. PCC 6803
WP_024712846  88 PGPSSIKTPIKLLKEGEIVGIFPSGTRTSE--DVPL--KRGAVTIAQMGKAPLVPAAYQ 142 Bacillus tequilensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap