Conserved Protein Domain Family
asnASE_II

?
TIGR00520: asnASE_II 
L-asparaginase, type II
Two related families of asparaginase (L-asparagine amidohydrolase, EC 3.5.1.1) are designated type I and type II according to the terminology in E. coli, which has both: L-asparaginase I is a low-affinity enzyme found in the cytoplasm, while L-asparaginase II is a high-affinity periplasmic enzyme synthesized with a cleavable signal sequence. This model describes L-asparaginases related to type II of E. coli. Both the cytoplasmic and the cell wall asparaginases of Saccharomyces cerevisiae belong to this set. Members of this set from Acinetobacter glutaminasificans and Pseudomonas fluorescens are described as having both glutaminase and asparaginase activitities. All members are homotetrameric. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273115
Aligned: 6 rows
Threshold Bit Score: 538.198
Threshold Setting Gi: 6685221
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11163     9 LSLFVAMSSGAPLLKIREEkNSSLPSIKIFGTGGTIASKGSTsATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNV 87  Saccharomyces cerev...
P00805     1 MEFFKKTALAALVMGFSGA-ALALPNITILATGGTIAGGGDS-ATKSNYTVGkVGVENLVNAVPQLKDIANVKGEQVVNI 78  Escherichia coli K-12
P43843     1 MKLTKLALCTLFGLGVSIAnAADLPNITILATGGTIAGSGQS-SVNSAYKAGqLSIDTLIEAVPEMKNIANIKGEQIVKI 79  Haemophilus influen...
O34482    27 KESPKEKAQTQKVSSASASeKKDLPNIRILATGGTIAGADQSkTSTTEYKAGvVGVESLIEAVPEMKDIANVSGEQIVNV 106 Bacillus subtilis s...
P38986    30 IPEILKSQNAAVNGSGIACqQRSLPRIKILGTGGTIASKAIDsSQTAGYHVD-LTIQDLLDAIPDISKVCDIEYEQLCNV 108 Saccharomyces cerev...
EMH37198   1 MRMFLKFLILLFCLKGQVM-AQNLPTIALLATGGTIAGSGVD-ASLGSYKSGeLGVKELLKAIPNLNKIARIQGEQVSNI 78  Helicobacter pylori...
P00805     1 MEFFKKTALAALVMGFSGA-ALALPNITILATGGTIAGGGDS-ATKSNYTVGkVGVENLVNAVPQLKDIANVKGEQVVNI 78  Escherichia coli K-12
P43843     1 MKLTKLALCTLFGLGVSIAnAADLPNITILATGGTIAGSGQS-SVNSAYKAGqLSIDTLIEAVPEMKNIANIKGEQIVKI 79  Haemophilus influen...
O34482    27 KESPKEKAQTQKVSSASASeKKDLPNIRILATGGTIAGADQSkTSTTEYKAGvVGVESLIEAVPEMKDIANVSGEQIVNV 106 Bacillus subtilis s...
P38986    30 IPEILKSQNAAVNGSGIACqQRSLPRIKILGTGGTIASKAIDsSQTAGYHVD-LTIQDLLDAIPDISKVCDIEYEQLCNV 108 Saccharomyces cerev...
EMH37198   1 MRMFLKFLILLFCLKGQVM-AQNLPTIALLATGGTIAGSGVD-ASLGSYKSGeLGVKELLKAIPNLNKIARIQGEQVSNI 78  Helicobacter pylori...
P11163    88 GSNSLNYTHLIPLYHGISEALASDdyAGAVVTHGTDTMEETAFFLDLTINS-EKPVCIAGAMRPATATSADGPMNLYQAV 166 Saccharomyces cerev...
P00805    79 GSQDMNDNVWLTLAKKINTDCDKT--DGFVITHGTDTMEETAYFLDLTVKC-DKPVVMVGAMRPSTSMSADGPFNLYNAV 155 Escherichia coli K-12
P43843    80 GSQDMNDEVWLKLAKAINAQCKST--DGFVITHGTDTMEETAYFLDLTVKC-EKPVVLVGAMRPATEKSADGPLNLYNAV 156 Haemophilus influen...
O34482   107 GSTNIDNKILLKLAKRINHLLASDdvDGIVVTHGTDTLEETAYFLNLTVKS-DKPVVIVGSMRPSTAISADGPSNLYNAV 185 Bacillus subtilis s...
P38986   109 DSKDINEDILYKIYKGVSESLQAFd--GIVITHGTDTLSETAFFIESTIDAgDVPIVFVGSMRPSTSVSADGPMNLYQAI 186 Saccharomyces cerev...
EMH37198  79 GSQDMNEEVWFKLAKRAQELLDDSriQGVVITHGTDTLEESAYFLNLVLRS-TKPVVLVGAMRNASSLSADGALNLYNAV 157 Helicobacter pylori...
P00805    79 GSQDMNDNVWLTLAKKINTDCDKT--DGFVITHGTDTMEETAYFLDLTVKC-DKPVVMVGAMRPSTSMSADGPFNLYNAV 155 Escherichia coli K-12
P43843    80 GSQDMNDEVWLKLAKAINAQCKST--DGFVITHGTDTMEETAYFLDLTVKC-EKPVVLVGAMRPATEKSADGPLNLYNAV 156 Haemophilus influen...
O34482   107 GSTNIDNKILLKLAKRINHLLASDdvDGIVVTHGTDTLEETAYFLNLTVKS-DKPVVIVGSMRPSTAISADGPSNLYNAV 185 Bacillus subtilis s...
P38986   109 DSKDINEDILYKIYKGVSESLQAFd--GIVITHGTDTLSETAFFIESTIDAgDVPIVFVGSMRPSTSVSADGPMNLYQAI 186 Saccharomyces cerev...
EMH37198  79 GSQDMNEEVWFKLAKRAQELLDDSriQGVVITHGTDTLEESAYFLNLVLRS-TKPVVLVGAMRNASSLSADGALNLYNAV 157 Helicobacter pylori...
P11163   167 SIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQ-FFDISNLTDpse 245 Saccharomyces cerev...
P00805   156 VTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDtPFDVSKLNE--- 232 Escherichia coli K-12
P43843   157 VVAADKKSSGRGVLVAMNNEVLGARDVTKTSTTAVQTFHSPNYGSLGYIHNSKVDYERSPESKHTINtPFNVEKLDS--- 233 Haemophilus influen...
O34482   186 KVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDTFKSEEMGFVGTIAD-DIYFNNEITRKHTKDtDFSVSNLDE--- 261 Bacillus subtilis s...
P38986   187 CIASNPKSRGRGVLVSLNDQISSGYYITKTNANSLDSFNVR-QGYLGNFVNNEIHYYYPPVKPQGCH-KFKLRVDGKhfk 264 Saccharomyces cerev...
EMH37198 158 SVAVNEKSANKGVLVVMDDTIFSAREVVKTHTTHTSTFKALNSGAIGSVYYGKARYYMQPLRKHTTEsEFSILELKTp-- 235 Helicobacter pylori...
P00805   156 VTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDtPFDVSKLNE--- 232 Escherichia coli K-12
P43843   157 VVAADKKSSGRGVLVAMNNEVLGARDVTKTSTTAVQTFHSPNYGSLGYIHNSKVDYERSPESKHTINtPFNVEKLDS--- 233 Haemophilus influen...
O34482   186 KVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDTFKSEEMGFVGTIAD-DIYFNNEITRKHTKDtDFSVSNLDE--- 261 Bacillus subtilis s...
P38986   187 CIASNPKSRGRGVLVSLNDQISSGYYITKTNANSLDSFNVR-QGYLGNFVNNEIHYYYPPVKPQGCH-KFKLRVDGKhfk 264 Saccharomyces cerev...
EMH37198 158 SVAVNEKSANKGVLVVMDDTIFSAREVVKTHTTHTSTFKALNSGAIGSVYYGKARYYMQPLRKHTTEsEFSILELKTp-- 235 Helicobacter pylori...
P11163   246 IPEVIILYSYQGLnPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYgIPIVHSRRTADGTVPPDDAP---- 321 Saccharomyces cerev...
P00805   233 LPKVGIVYNYANA-SDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTG-TAVVRSSRVPTGATTQDAEVdd-- 308 Escherichia coli K-12
P43843   234 LPKVGIIYAYSNA-PVEPLNALLNAGYQGIVSAGVGNGNVNAAHLDRLEKAAKDS-VVVVRSSRVPTGYTTRDAEVdd-- 309 Haemophilus influen...
O34482   262 LPQVDIIYGYQND-GSYLFDAAVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKG-VTVVRSTRTGNGVVTPNQDYae-- 337 Bacillus subtilis s...
P38986   265 LPEVCILYAHQAF-PPAIVNLVADK-YDGIVLATMGAGSLPEE---VNETCMKLS-LPIVYSKRSMDGMVPIANVPkkgs 338 Saccharomyces cerev...
EMH37198 236 LPKVDIIYTHAGM-TPDLFQASLKSHAKGVVIAGVGNGNVSAGFLKAMQEASQMG-VLIVRSSRVGSGEVT-SGEIdd-- 310 Helicobacter pylori...
P00805   233 LPKVGIVYNYANA-SDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTG-TAVVRSSRVPTGATTQDAEVdd-- 308 Escherichia coli K-12
P43843   234 LPKVGIIYAYSNA-PVEPLNALLNAGYQGIVSAGVGNGNVNAAHLDRLEKAAKDS-VVVVRSSRVPTGYTTRDAEVdd-- 309 Haemophilus influen...
O34482   262 LPQVDIIYGYQND-GSYLFDAAVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKG-VTVVRSTRTGNGVVTPNQDYae-- 337 Bacillus subtilis s...
P38986   265 LPEVCILYAHQAF-PPAIVNLVADK-YDGIVLATMGAGSLPEE---VNETCMKLS-LPIVYSKRSMDGMVPIANVPkkgs 338 Saccharomyces cerev...
EMH37198 236 LPKVDIIYTHAGM-TPDLFQASLKSHAKGVVIAGVGNGNVSAGFLKAMQEASQMG-VLIVRSSRVGSGEVT-SGEIdd-- 310 Helicobacter pylori...
P11163   322 --EYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFSGV 359 Saccharomyces cerevisiae S288c
P00805   309 akYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 348 Escherichia coli K-12
P43843   310 skYGFVASGTLNPQKARVLLQLALTQTKDPKVIQQYFEDF 349 Haemophilus influenzae Rd KW20
O34482   338 --kDLLASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY 375 Bacillus subtilis subsp. subtilis str. 168
P38986   339 keDNLIASGYLSPEKSRILLQLCLAGNYTLEEIKHVFTGV 378 Saccharomyces cerevisiae S288c
EMH37198 311 --kAFITSDNLNPQKARVLLQLALTKTNNKEKIQEMFEEY 348 Helicobacter pylori GAM83Bi
P00805   309 akYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY 348 Escherichia coli K-12
P43843   310 skYGFVASGTLNPQKARVLLQLALTQTKDPKVIQQYFEDF 349 Haemophilus influenzae Rd KW20
O34482   338 --kDLLASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY 375 Bacillus subtilis subsp. subtilis str. 168
P38986   339 keDNLIASGYLSPEKSRILLQLCLAGNYTLEEIKHVFTGV 378 Saccharomyces cerevisiae S288c
EMH37198 311 --kAFITSDNLNPQKARVLLQLALTKTNNKEKIQEMFEEY 348 Helicobacter pylori GAM83Bi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap