2D6F,2P2D


Conserved Protein Domain Family
asnASE_I

?
TIGR00519: asnASE_I 
Click on image for an interactive view with Cn3D
L-asparaginase, type I
Two related families of asparaginase are designated type I and type II according to the terminology in E. coli, which has both: L-asparaginase I is a low-affinity enzyme found in the cytoplasm, while L-asparaginase II is a high-affinity secreted enzyme synthesized with a cleavable signal sequence. This model describes L-asparaginases related to type I of E. coli. Archaeal putative asparaginases are of this type but contain an extra ~ 80 residues in a conserved N-terminal region. These archaeal homologs are included in this model.
Statistics
?
PSSM-Id: 129610
View PSSM: TIGR00519
Aligned: 7 rows
Threshold Bit Score: 510.13
Threshold Setting Gi: 114274
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D6F_A  90 LPDVSIISTGGTVASIIDYRTGAVHPA-FTADDLLRANPELLDIANIRG---RAVFNILSENMKPEYWVETARAVYGEIK 165 Methanothermobacter t...
O26802  90 LPDVSIISTGGTVASIIDYRTGAVHPA-FTADDLLRANPELLDIANIRG---RAVFNILSENMKPEYWVETARAVYGEIK 165 Methanothermobacter t...
O29380  80 LPDVKIISTGGTIASKVDYRTGAVTSQ-FTAEEIASEVPELTEICNVDA---ELLYNILSENMKPENWIELARHVYKALK 155 Archaeoglobus fulgidu...
P26900   1 MKKLLMLTTGGTIASVEGE--NGLAPG-VKADELLSYVSKLDNDYTMET---QSLMNIDSTNMQPEYWVEIAEAVKENYD 74  Bacillus subtilis sub...
P18840   3 KKSIYVAYTGGTIGMQRSE--QGYIPVsGHLQRQLALMPEFHRPEMPDFtihEYTPLMDSSDMTPEDWQHIAEDIKAHYD 80  Escherichia coli
Q60331  73 LKTISILSTGGTVASKVDYKTGAVHPS-FTADDLIRAVPELLDIANIKG---RAVMNILSENMKPEYWRKIAEEIKKEIE 148 Methanocaldococcus ja...
2P2D_A  23 KKSIYVAYTGGTIGMQRSE--QGYIPVsGHLQRQLALMPEFHRPEMPDFtihEYTPLMDSSDMTPEDWQHIAEDIKAHYD 100 Escherichia coli
2D6F_A 166 DgADGVVVAHGTDTMHYTSAALSFMLRT-PVPVVFTGAQRSSDRPSSDASLNIQCSVRAATSEIAEVTVCMHATMDDLSC 244 Methanothermobacter t...
O26802 166 DgADGVVVAHGTDTMHYTSAALSFMLRT-PVPVVFTGAQRSSDRPSSDASLNIQCSVRAATSEIAEVTVCMHATMDDLSC 244 Methanothermobacter t...
O29380 156 D-HEGVIITHGTDTMHFSAAALSFMLST-PKPVVFVGAQRSSDRPSSDAAMNLLCAAKAATEDIGEVVVCMHGSTSDDYC 233 Archaeoglobus fulgidu...
P26900  75 A-YDGFVITHGTDTMAYTSAALSYMLQHaKKPIVITGSQIPITFQKTDAKKNITDAIRFACEGV-----G--GVYVVFDG 146 Bacillus subtilis sub...
P18840  81 D-YDGFVILHGTDTMAYTASALSFMLENlGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYP------INEVTLFFNN 153 Escherichia coli
Q60331 149 EgADGIVIAHGTDTMSYTASALSFMVKA-DVPIILVGAQRSSDRPSSDAALNLISAVLAAREPIKGVYVVMHGESGDTFC 227 Methanocaldococcus ja...
2P2D_A 101 D-YDGFVILHGTDTMAYTASALSFMLENlGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYP------INEVTLFFNN 173 Escherichia coli
2D6F_A 245 HLHRGVKVRKMHTSRRDTFRSMNALPLAEVTP--DGIKILEENYRKRGSDELELSDRVEERVAFIKSYPGISPDIIKWHL 322 Methanothermobacter t...
O26802 245 HLHRGVKVRKMHTSRRDTFRSMNALPLAEVTP--DGIKILEENYRKRGSDELELSDRVEERVAFIKSYPGISPDIIKWHL 322 Methanothermobacter t...
O29380 234 LVHRGVKVRKNHTSRRDAFQSVNAKPIGRIDYpsLSVEWLSWRYR-RGERELKLTDRLERKVVLIKFFPGLSSDILEYYH 312 Archaeoglobus fulgidu...
P26900 147 RVIQGTRAIKLRTKSYDAFESINYPYIAFINE--DGIEYNKQVTE-PENDTFTVDTSLCTDVCLLKLHPGLKPEMFDALK 223 Bacillus subtilis sub...
P18840 154 RLYRGNRTTKAHADGFDAFASPNLPPLLEAGIh---IRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFL 230 Escherichia coli
Q60331 228 YLHKGVKVRKCHSSRRDAFKSINSIPVAKINPftKEIIYLQEVEKSDNSKKVEINTNLEEKVALIKVYPGMDGEIIRFYV 307 Methanocaldococcus ja...
2P2D_A 174 RLYRGNRTTKAHADGFDAFASPNLPPLLEAGIh---IRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFL 250 Escherichia coli
2D6F_A 323 DEGYRGIVIEGTGLGHCPDTL---IPVIGEAHDMGVPVAMTSQCLNGRVNMNVYSTGRRLLQAGVIPCDDMLPEVAYVKM 399 Methanothermobacter t...
O26802 323 DEGYRGIVIEGTGLGHCPDTL---IPVIGEAHDMGVPVAMTSQCLNGRVNMNVYSTGRRLLQAGVIPCDDMLPEVAYVKM 399 Methanothermobacter t...
O29380 313 SKGYRGFVIEGTGLGHVSTDW---IDTLRRVCEDSV-VVMTSQCLWGRVCDRVYDTGRDILRAGVIEGEDMLPEVALIKL 388 Archaeoglobus fulgidu...
P26900 224 SM-YKGIVIESYGSGGVPFEGrdiLSKVNELIESGIVVVITTQCLEEGEDMSIYEVGRRVNQDLIIRSRNMNTEAIVPKL 302 Bacillus subtilis sub...
P18840 231 RQPVKALILRSYGVGNAPQNKa-fLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKL 309 Escherichia coli
Q60331 308 DKEYKGIVLEGTGLGHAPEYI---FEHIKYATDKGVVVVMTTQTINGRVNMNVYSNGRELQKLGVIGCEDMPPEVALVKL 384 Methanocaldococcus ja...
2P2D_A 251 RQPVKALILRSYGVGNAPQNKa-fLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKL 329 Escherichia coli
2D6F_A 400 CWVLGQTDdPEMAREMMRENIAGEINE 426 Methanothermobacter thermautotrophicus str. Delta H
O26802 400 CWVLGQTDdPEMAREMMRENIAGEINE 426 Methanothermobacter thermautotrophicus str. Delta H
O29380 389 MWLLGNYS-IEEAKEMVKKSVAGEIEP 414 Archaeoglobus fulgidus DSM 4304
P26900 303 MWALGQSSdLPVVKRIMETPIADDVVL 329 Bacillus subtilis subsp. subtilis str. 168
P18840 310 HYLLSQELdTETIRKAMSQNLRGELTP 336 Escherichia coli
Q60331 385 MYLLGNYE-PEEVKKLINKNLVGEIEY 410 Methanocaldococcus jannaschii DSM 2661
2P2D_A 330 HYLLSQELdTETIRKAMSQNLRGELTP 356 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap