2VOE


Conserved Protein Domain Family
alaDH

?
TIGR00518: alaDH 
Click on image for an interactive view with Cn3D
alanine dehydrogenase
The family of known L-alanine dehydrogenases (EC 1.4.1.1) includes representatives from the Proteobacteria, Firmicutes, Cyanobacteria, and Actinobacteria, all with about 50 % identity or better. An outlier to this group in both sequence and gap pattern is the homolog from Helicobacter pylori, an epsilon division Proteobacteria, which must be considered a putative alanine dehydrogenase. In Mycobacterium smegmatis and M. tuberculosis, the enzyme doubles as a glycine dehydrogenase (1.4.1.10), running in the reverse direction (glyoxylate amination to glycine, with conversion of NADH to NAD+). Related proteins include saccharopine dehydrogenase and the N-terminal half of the NAD(P) transhydrogenase alpha subunit. All of these related proteins bind NAD and/or NADP. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129609
View PSSM: TIGR00518
Aligned: 4 rows
Threshold Bit Score: 605.369
Threshold Setting Gi: 499173833
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2VOE_A         1 MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWaD-ADLLLKVKEPIA 79  Mycobacterium t...
Q08352         1 MIIGVPKEIKNNENRVALTPGGVSQLISNGHRVLVETGAGLGSGFENEAYESAGAEIIADPKQVW-D-AEMVMKVKEPLP 78  Bacillus subtil...
WP_010871420   1 MEIGVPKEIKDQEFRVGLTPSSVRALLSQGHQVFVEEGAGVGSGFPDGAYAKAGAELVATAKEAW-N-RELVVKVKEPLP 78  Synechocystis s...
P30234         1 MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVW-AdADLLLKVKEPIA 79  Mycobacterium t...
2VOE_A        80 AEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADgALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVL 159 Mycobacterium t...
Q08352        79 EEYVYFRKGLVLFTYLHLAAEPELAQALKDKGVTAIAYETVSEGR-TLPLLTPMSEVAGRMAAQIGAQFLEKPKGGKGIL 157 Bacillus subtil...
WP_010871420  79 EEYEYLTLPKLLFTYLHLAAERTLTEALIKSGITAIAYETVELADgQLPLLAPMSRIAGRLAVQMGAHYLEKQQGGRGVL 158 Synechocystis s...
P30234        80 AEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADgALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVL 159 Mycobacterium t...
2VOE_A       160 MGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAV 239 Mycobacterium t...
Q08352       158 LAGVPGVSRGKVTIIGGGVVGTNAAKMAVGLGADVTIIDLNADRLRQLDDIFGHQIKTLISNPVNIADAVAEADLLICAV 237 Bacillus subtil...
WP_010871420 159 LGGVPGVKAGQVTILGGGVVGTEAAKMAIGLGAMVTILDINVDRLNQLGELFGSRVDLRYSNASQIEDLLPHTDLLIGAV 238 Synechocystis s...
P30234       160 MGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAV 239 Mycobacterium t...
2VOE_A       240 LVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSR-PTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATM 318 Mycobacterium t...
Q08352       238 LIPGAKAPTLVTEEMVKQMKPGSVIVDVAIDQGGIVETVDhITTHDQPTYEKHGVVHYAVANMPGAVPRTSTIALTNVTV 317 Bacillus subtil...
WP_010871420 239 LITGKRAPVLVSRQEVEQMLPGAVIMDVAIDQGGCVETLR-VTSHSQPSYIEAEVVHVGIPNMPGATPWTATQALNNSTL 317 Synechocystis s...
P30234       240 LVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSR-PTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATM 318 Mycobacterium t...
2VOE_A       319 PYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA 371 Mycobacterium tuberculosis
Q08352       318 PYALQIANKGAVKALADNTALRAGLNTANGHVTYEAVARDLGYEYVPAEKALQ 370 Bacillus subtilis subsp. subtilis str. 168
WP_010871420 318 RYVLKLANLG-EQAWENDLPLAKGVNVQAGKLVQGAVKTVFPDL--------- 360 Synechocystis sp. PCC 6803
P30234       319 PYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA 371 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap