2F9Y


Conserved Protein Domain Family
accD

?
TIGR00515: accD 
Click on image for an interactive view with Cn3D
acetyl-CoA carboxylase, carboxyl transferase, beta subunit
The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129606
View PSSM: TIGR00515
Aligned: 6 rows
Threshold Bit Score: 503.18
Threshold Setting Gi: 505197251
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F9Y_B         1 MSWIERIKSN---------ITPTR----KASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDE 67  Escherichia coli
P08193         1 MSWIERIKSN---------ITPTR----KASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDE 67  Escherichia coli
P43778         1 MSWINRIFSKs-------pSSSTR----KANVPEGVWTKCTACEQVLYSEELKRNLYVCPKCGHHMRIDARERLLNLLDE 69  Haemophilus inf...
Q57417         1 MSLFDWFANRekaeppvlqPQSPQ----EREVADGLWTKCPACGVLTYTKDLQGNWMVCVECGHHLRVDSDERIRQLIDA 76  Synechocystis s...
WP_000505053   1 MGFADFFKNFki-----nkLRTAP----SKEEQPSHWVKCPKCYALMYHKEVFSKYSVCLKCHYHFRMKAAERIEFLCDV 71  Helicobacter py...
WP_015384353  15 hllkDIFTKKk-------kYASVPsdqaKHDVPEGIMTKCPKCKKIMLTKELDKNMRVCMNCDYHFPMNAKQRIESLMDE 87  Bacillus subtilis
2F9Y_B        68 GSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVE 147 Escherichia coli
P08193        68 GSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVE 147 Escherichia coli
P43778        70 DSSQEIAADLEPKDILKFKDLKKYKDRINAAQKETGEKDALITMTGTLYNMPIVVAASNFAFMGGSMGSVVGAKFVKAAE 149 Haemophilus inf...
Q57417        77 KTWQPINEHLRPTDPLKFKDRKSYKDRIRDTQKATDLTDAVQTGHGRLDGLPIALGVMDFRFMGGSMGSVVGEKLCRLIE 156 Synechocystis s...
WP_000505053  72 GSFEEFDKHLRPNDPLNFVDKESYKQRIKKYEKRTNRPSSVISGEAKINRMPLQIVVFDFSFMGGSLGSVEGEKIVRAIN 151 Helicobacter py...
WP_015384353  88 QSFEEFNQGMLSENPLGFPG---YLEKLEKDREKTSLNEAVVTGKGTIGGHPAVVAVMDSSFRMGSMGSVVGEKITLAIE 164 Bacillus subtilis
2F9Y_B       148 QALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGF 227 Escherichia coli
P08193       148 QALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGF 227 Escherichia coli
P43778       150 KAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVSASFAMLGDLNIAEPKALIGF 229 Haemophilus inf...
Q57417       157 YATLERLPVVIICASGGARMQEGMLSLMQMAKISGALQNHREQKLLYIPVLTHPTTGGVTASFAMLGDLILAEPKATIGF 236 Synechocystis s...
WP_000505053 152 RAVAKREALLIVSASGGARMQESTYSLMQMAKTSAALNRLSEAKLPFISLLSDPTYGGVSASFAFLGDLIIAEPGAMIGF 231 Helicobacter py...
WP_015384353 165 KAKADKVPFIIFTASGGARMQEGVLSLMQMAKTSSALKLFSEEQGLIISVMTHPTTGGVSASFASLGDYNFAEPGALIGF 244 Bacillus subtilis
2F9Y_B       228 AGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAP 283 Escherichia coli
P08193       228 AGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAP 283 Escherichia coli
P43778       230 AGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKLTNQPSP 285 Haemophilus influenzae Rd KW20
Q57417       237 AGRRVIEQTLREKLPDDFQTSEYLLHHGFVDAIVPRPQLKRTLAQLISLHQPFYPI 292 Synechocystis sp. PCC 6803 substr. Kazusa
WP_000505053 232 AGPRVIKQTIGADLPEGFQTAEFLLEHGLIDMIVHRKDLKKTLSDLIAMMTHKTSK 287 Helicobacter pylori
WP_015384353 245 AGRRIIEQTIGEKLPEDFQTAEFLLKHGQLDAVIHRDDMKKTLENLLDMHQTGGDI 300 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap