3RUP


Conserved Protein Domain Family
accC

?
TIGR00514: accC 
Click on image for an interactive view with Cn3D
acetyl-CoA carboxylase, biotin carboxylase subunit
This model represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase. Acetyl-CoA carboxylase is designated EC 6.4.1.2 and this component, biotin carboxylase, has its own designation, EC 6.3.4.14. Homologous domains are found in eukaryotic forms of acetyl-CoA carboxylase and in a number of other carboxylases (e.g. pyruvate carboxylase), but seed members and trusted cutoff are selected so as to exclude these. In some systems, the biotin carboxyl carrier protein and this protein (biotin carboxylase) may be shared by different carboxyltransferases. However, this model is not intended to identify the biotin carboxylase domain of propionyl-coA carboxylase. The model should hit the full length of proteins, except for chloroplast transit peptides in plants. If it hits a domain only of a longer protein, there may be a problem with the identification. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129605
View PSSM: TIGR00514
Aligned: 7 rows
Threshold Bit Score: 800.513
Threshold Setting Gi: 498416541
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3RUP_A         4 MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHP 83  Escherichia col...
P43873         1 MLEKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETICIGPAPSAKSYLNIPAIIAAAEVTGADAIHP 80  Haemophilus inf...
Q06862         2 KFDKILIANRGEIALRILRACEEMGIATIAVHSTVDRNALHVQLADEAVCIGEPASAKSYLNIPNIIAAALTRNASAIHP 81  Nostoc sp. PCC ...
AAC09008      73 GGDKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADEAVCIGEAPSNQSYLVIPNVLSAAISRGCTMLHP 152 thale cress
P24182         1 MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHP 80  Escherichia col...
BAA12569       1 MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMADEAFCIGPKASKDSYLNVTNIVSVAKLTGTDAIHP 80  Bacillus subtilis
WP_010725079   1 -MKKVLIANRGEIAIRIIRACHDLGLATVAVYSMADQEALHVLLADEAVCIGEAQAAKSYLKIANILAACEITGVDAVHP 79  Chlamydia trach...
3RUP_A        84 GYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGpLGDDMDKNRAIAKRIGYPVIIKA 163 Escherichia col...
P43873        81 GYGFLSENADFAEQVERSGFTFIGPTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGpVSNDIAKNKEIAKRIGYPIIIKA 160 Haemophilus inf...
Q06862        82 GYGFLSENAKFAEICADHHIAFIGPTPEAIRLMGDKSTAKETMQKAGVPTVPGSEG-LVETEQEGLELAKDIGYPVMIKA 160 Nostoc sp. PCC ...
AAC09008     153 GYGFLSENALFVEMCRDHGINFIGPNPDSIRVMGDKATARETMKNAGVPTVPGSDG-LLQSTEEAVRVANEIGFPVMIKA 231 thale cress
P24182        81 GYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGpLGDDMDKNRAIAKRIGYPVIIKA 160 Escherichia col...
BAA12569      81 GYGFLAENADFAELCEEVNVTFVGPSPDAISKMGTKDVARETMKQAGVPIVPGSQG-IIENVEEAVSLANEIGYPVIIKA 159 Bacillus subtilis
WP_010725079  80 GYGFLSENANFASICESCGLTFIGPSAESIATMGDKVAAKQLAKKIKCPVIPGSEG-VVKDEVEGIRIAEKIGFPIVIKA 158 Chlamydia trach...
3RUP_A       164 SGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV 243 Escherichia col...
P43873       161 SGGGGGRGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRHVEIQVLADTHGNAVYLAERDCSMQRRHQKVV 240 Haemophilus inf...
Q06862       161 TAGGGGRGMRLVRSPDEFVKLFLAAQGEAGAAFGNAGVYIEKFIERPRHIEFQILADNYGNVIHLGERDCSIQRRNQKLL 240 Nostoc sp. PCC ...
AAC09008     232 TAGGGGRGMRLAKEPGEFVKLLQQAKSEAAAAFGNDGCYLEKFVQNPRHIEFQVLADKFGNVVHFGERDCSIQRRNQKLL 311 thale cress
P24182       161 SGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV 240 Escherichia col...
BAA12569     160 TAGGGGKGIRVARTEEELINGIKITQQEAATAFRNPGVYIEKYIEDFRHVEIQVLADNYGNTIHLGERDCSIQRRLQKLL 239 Bacillus subtilis
WP_010725079 159 VAGGGGRGIRIVREKDEFYRAFTAARAEAEAGFNNPDVYIEKFIENPRHLEVQVIGDKHGNYVYLGERDCTVQRRRQKLI 238 Chlamydia trach...
3RUP_A       244 EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFE-NGE-FYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAG 321 Escherichia col...
P43873       241 EEAPAPGITEEVRRDIGSRCANACVEIGYRGAGTFEFLYE-NGE-FYFIEMNTRIQVEHPVTEMITGVDLVKEQLRIAAG 318 Haemophilus inf...
Q06862       241 EEAPSPALDSDLREKMGQAAVKAAQFINYTGAGTIEFLLDrSGQ-FYFMEMNTRIQVEHPVTEMVTGVDLLVEQIRIAQG 319 Nostoc sp. PCC ...
AAC09008     312 EEAPSPALTAELRKAMGDAAVAAAASIGYIGVGTVEFLLDeRGS-FYFMEMNTRIQVEHPVTEMIYSVDLIEEQIRVAMG 390 thale cress
P24182       241 EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFE-NGE-FYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAG 318 Escherichia col...
BAA12569     240 EESPSPALDSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDyNEQrYYFMEMNTRIQVEHPVTEMVTGTDLIKEQIKVASG 319 Bacillus subtilis
WP_010725079 239 EETPSPILTPEMRAKVGKVAVDLARSAGYFSVGTVEFLLDkEKR-FYFMEMNTRIQVEHTITEEVTGIDLLKAQISVAKG 317 Chlamydia trach...
3RUP_A       322 QPLSIKQEEVHVRGHAVECRINAEDP-NTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDV 400 Escherichia col...
P43873       319 LPISFKQEDIKVKGHAMECRINAEDP-KTFLPSPGKVNHLHSPGGLGVRWDSHVYGGYTVPPHYDSMIAKLITYGDTREV 397 Haemophilus inf...
Q06862       320 ERLRLTQDQVVLRGHAIECRINAEDPdHDFRPAPGRISGYLPPGGPGVRIDSHVYTDYQIPPYYDSLIGKLIVWGPDRAT 399 Nostoc sp. PCC ...
AAC09008     391 EKLRYKQEDIVLRGHSIECRINAEDPfKGFRPGPGRITSYLPSGGPFVRMDSHVYSDYVVPPSYDSLLGKLIVWAPTREK 470 thale cress
P24182       319 QPLSIKQEEVHVRGHAVECRINAEDP-NTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDV 397 Escherichia col...
BAA12569     320 MELSLKQEDVEFEGWAIECRINAENPsKNFMPSPGEIKMYLPPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDE 399 Bacillus subtilis
WP_010725079 318 EKLPWKQKNIKFKGHVIQCRINAEDPiNNFTPSPGRLDYYLPPAGPAVRVDGACYSGYAIPPYYDSMIAKVITKGKNREE 397 Chlamydia trach...
3RUP_A       401 AIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGLQE 451 Escherichia coli K-12
P43873       398 AIRRMQNALSETIIDGIKTNIPLHELILEDENFQKGGTNIHYLEKKLGMNE 448 Haemophilus influenzae Rd KW20
Q06862       400 AINRMKRALRECAITGLPTTIGFHQRIMENPQFLQGNVSTSFVQEMNK--- 447 Nostoc sp. PCC 7120
AAC09008     471 AIERMKRALNDTIITGVPTTINYHKLILDVEDFKNGKVDTAFIVKHEEELA 521 thale cress
P24182       398 AIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGLQE 448 Escherichia coli K-12
BAA12569     400 AIARMKRALSEFVIEGIETTIPFHLKLLEHETFVSGEFNTKFLETYDVMGS 450 Bacillus subtilis
WP_010725079 398 AIAIMKRALKEFHIGGVHSTIPFHQFMLDNPKFLLSDYDINYVDQLLASGS 448 Chlamydia trachomatis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap