1NYT,1P74,1NVT,3PHG


Conserved Protein Domain Family
aroE

?
TIGR00507: aroE 
Click on image for an interactive view with Cn3D
shikimate dehydrogenase
This model finds proteins from prokaryotes and functionally equivalent domains from larger, multifunctional proteins of fungi and plants. Below the trusted cutoff of 180, but above the noise cutoff of 20, are the putative shikimate dehydrogenases of Thermotoga maritima and Mycobacterium tuberculosis, and uncharacterized paralogs of shikimate dehydrogenase from E. coli and H. influenzae. The related enzyme quinate 5-dehydrogenase scores below the noise cutoff. A neighbor-joining tree, constructed with quinate 5-dehydrogenases as the outgroup, shows the Clamydial homolog as clustering among the shikimate dehydrogenases, although the sequence is unusual in the degree of sequence divergence and the presence of an additional N-terminal domain. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 161904
View PSSM: TIGR00507
Aligned: 11 rows
Threshold Bit Score: 353.259
Threshold Setting Gi: 2492955
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NYT_A   2 ETYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPIND--FINTLNAFFSAGGKGANVTVPFKEEAFARADELTERA 79  Escherichia coli
P43876   2 DLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDA--FEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRA 79  Haemophilus influenza...
P15770   2 ETYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPIND--FINTLNAFFSAGGKGANVTVPFKEEAFARADELTERA 79  Escherichia coli K-12
P56119   4 KSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPILLplESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIA 83  Helicobacter pylori 2...
Q58484   7 KVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPEN--LKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDA 84  Methanocaldococcus ja...
O27957   2 LYLGVIGYPIKHSVSPAMHNAALQHEGIEGIYLAFEVKPDR--LRDAVFGAKALGFRGLNVTIPFKESVVEFV-ELEGEA 78  Archaeoglobus fulgidu...
O84375 215 PICALIGDTSR-SIGHLTHNPFFSQLGVACPYIKLPLTPQE--LPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSV 291 Chlamydia trachomatis...
P54374   3 KLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEEND--LEDAVKGIRALGVQGINVTVPHKVSIMDYLDHIDESA 80  Bacillus subtilis sub...
1P74_A   2 DLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDA--FEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRA 79  Haemophilus influenza...
1NVT_A  12 KVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPEN--LKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDA 89  Methanocaldococcus ja...
3PHG_A   4 KSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPILLplESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIA 83  Helicobacter pylori 2...
1NYT_A  80 ALAGAVNTLMrLEDGRLLGDNTDGVGLLSDLER-LSFIRPGLRILLIGAGGASRGVLLPLLSL-DCAVTITNRTVSRAEE 157 Escherichia coli
P43876  80 KLAEACNTLKkLDDGKLYADNTDGIGLVTDLQR-LNWLRPNQHVLILGAGGATKGVLLPLLQA-QQNIVLANRTFSKTKE 157 Haemophilus influenza...
P15770  80 ALAGAVNTLMrLEDGRLLGDNTDGVGLLSDLER-LSFIRPGLRILLIGAGGASRGVLLPLLSL-DCAVTITNRTVSRAEE 157 Escherichia coli K-12
P56119  84 LECGAVNTLV-LENDELVGYNTDALGFYLSLKQ-----KNYQNALILGAGGSAKALACELKKQ-GLQVSVLNRS-SRG-- 153 Helicobacter pylori 2...
Q58484  85 QLIGAVNTIK-IEDGKAIGYNTDGIGARMALEEeIGRVK-DKNIVIYGAGGAARAVAFELAK--DNNIIIANRTVEKAEA 160 Methanocaldococcus ja...
O27957  79 AKIKTVNTID-LVE--MVGYNTDVYGVKAALSG--TELG-GKTALVVGAGGAGKAAALALLDM-GSTVIVANRTEEKGRE 151 Archaeoglobus fulgidu...
O84375 292 KASGSCNTLV-IRQGEIEGHDTDGEGLFSVLMQhQIPLN-NQRVAIIGAGGAAQSIATRLSRA-NCELLIFNRTKAHAED 368 Chlamydia trachomatis...
P54374  81 KVLGAVNTVR-REGDKLVGYNTDGEGFVKSLMKvLDKPISELSFLMIGAGGAARAIFTTIVRNtPKKFDICNRTLEKAKR 159 Bacillus subtilis sub...
1P74_A  80 KLAEACNTLKkLDDGKLYADNTDGIGLVTDLQR-LNWLRPNQHVLILGAGGATKGVLLPLLQA-QQNIVLANRTFSKTKE 157 Haemophilus influenza...
1NVT_A  90 QLIGAVNTIK-IEDGKAIGYNTDGIGARMALEE-EIGRVKDKNIVIYGAGGAARAVAFELAK--DNNIIIANRTVEKAEA 165 Methanocaldococcus ja...
3PHG_A  84 LECGAVNTLV-LENDELVGYNTDALGFYLSLKQ-----KNYQNALILGAGGSAKALACELKKQ-GLQVSVLNRS-SRG-- 153 Helicobacter pylori 2...
1NYT_A 158 LAKLFAH-----TGSIQALSMDELEGHE--FDLIINATSSGISGDI---PAIPSSLIHPGIYCYDMFYQKG-KTPFLAWC 226 Escherichia coli
P43876 158 LAERFQP-----YGNIQAVSMDSIPLQT--YDLVINATSAGLSGGT---ASVDAEILKLGSAFYDMQYAKGtDTPFIALC 227 Haemophilus influenza...
P15770 158 LAKLFAH-----TGSIQALSMDELEGHE--FDLIINATSSGISGDI---PAIPSSLIHPGIYCYDMFYQKG-KTPFLAWC 226 Escherichia coli K-12
P56119 154 -LDFFQR-----LGCDCFME----PPKSa-FDLIINATSASLHNELplnKEVLKGYFKEGKLAYDLAYGFL--TPFLSLA 220 Helicobacter pylori 2...
Q58484 161 LAKEIAEklnkkFGEEVKFSGLDVDLDG--VDIIINATPIGMYPNIdvePIVKAEKLREDMVVMDLIYNPL-ETVLLKEA 237 Methanocaldococcus ja...
O27957 152 AVEMLRR-----YGECIFWPLSRVEELKgkVDVVVNATPLGMRGFKa-eIPVPPSMLDGVELVFDTVYNPM-ETPLIREA 224 Archaeoglobus fulgidu...
O84375 369 LASRCQA---------KAFSLEELPLHR--VSLIINCLPPSCTIPK----------AVAP-CVVDINTIPK-HSTFTQYA 425 Chlamydia trachomatis...
P54374 160 LTEATPSf---hNKEVLSIKEAEERLEQ--YDVIIHTTSVGMYPNVd-dVPLSLQRAASSAVVCDIVYNPI-QTALLKEA 232 Bacillus subtilis sub...
1P74_A 158 LAERFQP-----YGNIQAVSMDSIPLQT--YDLVINATSAGLSGGTa---SVDAEILKLGSAFYDMQYAKGtDTPFIALC 227 Haemophilus influenza...
1NVT_A 166 LAKEIAEklnkkFGEEVKFSGLDVDLDG--VDIIINATPIGMYPNIdvePIVKAEKLREDMVVMDLIYNPL-ETVLLKEA 242 Methanocaldococcus ja...
3PHG_A 154 -LDFFQR-----LGCDCFM---EPPKSA--FDLIINATSASLHNELplnKEVLKGYFKEGKLAYDLAYGFL--TPFLSLA 220 Helicobacter pylori 2...
1NYT_A 227 EQRG-SKrNADGLGMLVAQAAHAFLLWHGVL--PDVEPVIKQLQEELS 271 Escherichia coli
P43876 228 KSLGlTN-VSDGFGMLVAQAAHSFHLWRGVM--PDFVSVYEQLKKAML 272 Haemophilus influenzae Rd KW20
P15770 227 EQRGsKR-NADGLGMLVAQAAHAFLLWHGVL--PDVEPVIKQLQEELS 271 Escherichia coli K-12
P56119 221 KELK-TP-FQDGKDMLIYQAALSFEKFSASQ--IPYSKAFEVMRSVF- 263 Helicobacter pylori 26695
Q58484 238 KKVN-AK-TINGLGMLIYQGAVAFKIWTGVE--PNIEVMKNAIIDKIT 281 Methanocaldococcus jannaschii DSM 2661
O27957 225 KKRG-CK-VVYGIEMLVHQGAKAFEIWTGIE--PDVGVMREAALRALR 268 Archaeoglobus fulgidus DSM 4304
O84375 426 RSQG-SS-IIYGHEMFTQQALLQFRLWFPTLsfKHLEKTFIRRAAVLA 471 Chlamydia trachomatis D/UW-3/CX
P54374 233 SQKG-LK-TLDGVGMFVEQAALSFQLWTGQE--PNIEKMRSIVIGKLG 276 Bacillus subtilis subsp. subtilis str. 168
1P74_A 228 KSLGlTN-VSDGFGMLVAQAAHSFHLWRGVM--PDFVSVYEQLKKAML 272 Haemophilus influenzae Rd KW20
1NVT_A 243 KKVN-AK-TINGLGMLIYQGAVAFKIWTGVE--PNIEVMKNAIIDKIT 286 Methanocaldococcus jannaschii
3PHG_A 221 KELK-TP-FQDGKDMLIYQAALSFEKFSASQ--IPYSKAFEVMRSVFh 264 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap