Conserved Protein Domain Family
pyro_pdase

?
TIGR00504: pyro_pdase 
pyroglutamyl-peptidase I
Alternate names include pyroglutamate aminopeptidase, pyrrolidone-carboxylate peptidase, and 5-oxoprolyl-peptidase. It removes pyroglutamate (pyrrolidone-carboxylate, a modified glutamine) that can otherwise block hydrolysis of a polypeptide at the amino end, and so can be extremely useful in the biochemical studies of proteins. The biological role in the various species in which it is found is not fully understood. The enzyme appears to be a homodimer. It does not closely resemble any other peptidases. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 129595
View PSSM: TIGR00504
Aligned: 4 rows
Threshold Bit Score: 314.86
Threshold Setting Gi: 6093659
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O07930   3 KVLVTGFGPYGVTPVNPAQLTAEELDGRTIaG-ATVISRIVPNTFFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVER 81  Mycobacterium tubercu...
P28618   4 KVLITGFDPFDKETVNPSWEAAKRLNGFET-EeAIITAEQIPTVFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPER 82  Bacillus subtilis sub...
P42673   3 IVLLTGFEPFDQDPVNPSWEAVRQLDGVQLgSdVKIVARRLPCAFATAGECLTRLIDELHPAMVIATGLGPGRSDISVER 82  Pseudomonas fluorescens
O58321   2 KILLTGFEPFGGDDKNPTMDIVEALSERIP----EVVGEILPVSFKRAREKLLKVLDDVRPDITINLGLAPGRTHISVER 77  Pyrococcus horikoshii...
O07930  82 LAQNVNDCGrygLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKG 161 Mycobacterium tubercu...
P28618  83 VAINLADAR---IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTS 159 Bacillus subtilis sub...
P42673  83 VAININDAR---IPDNLGEQPIDTAVVADGPAAFFTTLPIKAMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAGSG 159 Pseudomonas fluorescens
O58321  78 VAVNMIDAR---IPDNDGEQPKDEPIVEGGPAAYFATIPTREIVEEMKKNGIPAVLSYTAGTYLCNFAMYLTLHTSATKG 154 Pyrococcus horikoshii...
O07930 162 LPVRAGWIHLPCLPSVAALDhnlGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIpSRLQ 221 Mycobacterium tuberculosis
P28618 160 PHIRGGFIHIPYIPQQTIDK---TAPSLSLDTIVRALRIAAVTAAQYDEDVKSPG-GTLH 215 Bacillus subtilis subsp. subtilis str. 168
P42673 160 --VRSGFIHVPFLPEQVAGS---QRPSMALDAMVAGLQAAVLTAWHTPVDVKEAG-GQVS 213 Pseudomonas fluorescens
O58321 155 YPKIAGFIHVPYTPDQVLEKk--NTPSMSLDLEIKGVEIAIRVAQSALHSSQLR------ 206 Pyrococcus horikoshii OT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap