1HOR,3HN6


Conserved Protein Domain Family
nagB

?
TIGR00502: nagB 
Click on image for an interactive view with Cn3D
glucosamine-6-phosphate isomerase
The set of proteins recognized by this model includes a closely related pair from Bacillus subtilis, one of which is uncharacterized but included as a member of the orthologous set. [Central intermediary metabolism, Amino sugars]
Statistics
?
PSSM-Id: 129593
View PSSM: TIGR00502
Aligned: 7 rows
Threshold Bit Score: 427.307
Threshold Setting Gi: 3122426
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HOR_A   1 MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKE 80  Escherichia coli BW2952
P44538   1 MRFIPLQTEQQVSCWAAQHIINRINDFKPTAERPFVLGLPTGGTPLKTYQELIRLYQAGKVSFKHVVTFNMDEYVALPEE 80  Haemophilus influenza...
O30564   1 MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEEN 80  Borrelia burgdorferi B31
O35000   1 MKVMECQTYEELSQIAARITADTIKE-KPD-A---VLGLATGGTPEGTYRQLIRLHQTENLSFQNITTVNLDEYAGLSSD 75  Bacillus subtilis sub...
O31458   1 MKILIAEHYEELCKLSAAIIKEQIQA-KKD-A---VLGLATGSTPVGLYKQLISDYQAGEIDFSKVTTFNLDEYAGLSPS 75  Bacillus subtilis sub...
P09375   1 MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKE 80  Escherichia coli
3HN6_A  22 MRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEEN 101 Borrelia burgdorferi B31
1HOR_A  81 HPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK 160 Escherichia coli BW2952
P44538  81 HPESYHSFMYNNFFNHIDILPENINILNGNTDDHNAECRRYEEKIKSYGKIHLFMGGVGVDGHIAFNEPASSLSSRTRIK 160 Haemophilus influenza...
O30564  81 HPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIK 160 Borrelia burgdorferi B31
O35000  76 DPNSYHFYMNDRFFQHIDSKPSRHFIPNGNADDLEAECRRYEQLVDSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVV 155 Bacillus subtilis sub...
O31458  76 HPQSYNHFMHEHLFQHINMQPDHIHIPQGDNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVV 155 Bacillus subtilis sub...
P09375  81 HPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIK 160 Escherichia coli
3HN6_A 102 HPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIK 181 Borrelia burgdorferi B31
1HOR_A 161 TLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVC 239 Escherichia coli BW2952
P44538 161 TLTQDTLIANSRFFNNDVTQVPKYALTIGVGTLLD-AEEVMILATGHQKALAVQAAVEGSINHLWTVSALQMHRHFLLVC 239 Haemophilus influenza...
O30564 161 TLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMD-SQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVS 239 Borrelia burgdorferi B31
O35000 156 TLNEQTRQANARYFP-SIDSVPKKALTMGIQTILS-SKRILLLISGKSKAEAVRKLLEGNISEDFPASALHLHSDVTVLI 233 Bacillus subtilis sub...
O31458 156 KLSESTIQANARFFGGDPVLVPRLAISMGIKTIMEfSKHIVLLASGEEKADAIQKMAEGPVTTDVPASILQKHNHVTVIA 235 Bacillus subtilis sub...
P09375 161 TLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLD-AEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVC 239 Escherichia coli
3HN6_A 182 TLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMD-SQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVS 260 Borrelia burgdorferi B31
1HOR_A 240 DEPSTMELKVKTLRYFNELE 259 Escherichia coli BW2952
P44538 240 DEAAQQELKVKTVKYFTELE 259 Haemophilus influenzae Rd KW20
O30564 240 DKNATYELKVGTVEYFNDIE 259 Borrelia burgdorferi B31
O35000 234 DREAASLRP----------- 242 Bacillus subtilis subsp. subtilis str. 168
O31458 236 DYKAAQKLKSASFS------ 249 Bacillus subtilis subsp. subtilis str. 168
P09375 240 DEPSTMELKVKTLRYFNELE 259 Escherichia coli
3HN6_A 261 DKNATYELKVGTVEYFNDIE 280 Borrelia burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap