Conserved Protein Domain Family
met_pdase_II

?
TIGR00501: met_pdase_II 
methionine aminopeptidase, type II
Methionine aminopeptidase (map) is a cobalt-binding enzyme. Bacterial and organellar examples (type I) differ from eukaroytic and archaeal (type II) examples in lacking a region of approximately 60 amino acids between the 4th and 5th cobalt-binding ligands. The role of this protein in general is to produce the mature amino end of cytosolic proteins by removing the N-terminal methionine. This model describes type II, among which the eukaryotic members typically have an N-terminal extension not present in archaeal members. It can act cotranslationally. The enzyme from rat has been shown to associate with translation initiation factor 2 (IF-2) and may have a role in translational regulation. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129592
View PSSM: TIGR00501
Aligned: 4 rows
Threshold Bit Score: 465.029
Threshold Setting Gi: 3122371
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA56011  23 DLERAEHWndVRKGaEIHRRVRRAIKDRIVPGMKLMDIADMIENTTRKYtGAEnllamedPksqgiGFPTGLSLNHCAAH 102 baker's yeast
O27355     1 MIKMIESY--LKAG-KIVSKVRREAAGIIRDGLPIIELVNYVEDRIIEE-GGR-------P-----AFPCNVSVNEVTAH 64  Methanothermobacter...
O28438     2 DDEVREKL--IEAG-KILKQAVNEAAEKIAPGVKILEVAEFVENRIIEL-GAK-------P-----AFPANISINSDAAH 65  Archaeoglobus fulgi...
Q58725     2 EIEGYEKI--IEAG-KIASKVREEAVKLIXPGVKLLEVAEFVENRIREL-GGE-------P-----AFPCNISINEIAAH 65  Methanocaldococcus ...
CAA56011 103 FTPNAGDKTVLKYEDVMKVDYGVQVNGNIIDSAFTVSFDPQ---YDNLLAAVKDATYTGIKEAGIDVRLTDIGEAIQEVM 179 baker's yeast
O27355    65 YTSPPGDDSVIGDGDLVKLDLGAHVDGFIADTAITVPVGDVddkCHQMMDAAREALENAISTIRAGVEVGEIGRVIEETI 144 Methanothermobacter...
O28438    66 FTPKKNDERTFKEGDVVKLDVGAHIDGYIADMAVTVDLGDN----TELVKAAKEALEAAMEVVRAGVSVSEIGKAIEDAI 141 Archaeoglobus fulgi...
Q58725    66 YTPKLNDNLEFKDDDVVKLDLGAHVDGYIADTAITVDLSNS---YKDLVKASEDALYTVIKEINPPMNIGEMGKIIQEVI 142 Methanocaldococcus ...
CAA56011 180 ESyeveingetYQVKPCRNLCGHSIAPYRIHGGKSVPIVKNGDTTKMEEGEHFAIETFGSTGRGYVTAGGEVSHYARSAE 259 baker's yeast
O27355   145 HS---------HGMNPVSNLTGHSMERWILHSGLSIPNINERNTHQLEEGDVLAIEPFATDGVGLVTDMPQTYIFRFLRE 215 Methanothermobacter...
O28438   142 TN---------YGFKPIVNLTGHGLLPYLNHAPPSIYNYATEKGVTLEEGMVVAIEPFATNGVGKVGERGECEIYSLLNP 212 Archaeoglobus fulgi...
Q58725   143 ES---------YGYKPISNLSGHVMHRYELHTGISIPNVYERTNQYIDVGDLVAIEPFATDGFGMVKDGNLGNIYKFLAK 213 Methanocaldococcus ...
CAA56011 260 dHQVMptLDSAKNLLKTIDRNFGTLPFCRRYLDRLGQEK-YLFALNNLVRHGLVQDYPPLNDIPGSYTAQFEHTILLHAH 338 baker's yeast
O27355   216 -RPLR--LVHARRVLGKIREEYHALPFAQRWLEEYFDAKrLNASMRMLIQSRAIYPYHVLREKSGAMVAQWEHTVIVEED 292 Methanothermobacter...
O28438   213 -RPVR--MKMAREILKEVEENYKTLPFAKRWLKKAPD---I--IISKLAREGVLRAYPVLTEVSGGLVSQWEHTLIVEDG 284 Archaeoglobus fulgi...
Q58725   214 -RPIR--LPQARKLLDVISKNYPYLPFAERWVLKNES---ERLALNSLIRASCIYGYPILKERENGIVGQAEHTILITEN 287 Methanocaldococcus ...
CAA56011 339 KKEVVSK 345 baker's yeast
O27355   293 GCTVITE 299 Methanothermobacter thermautotrophicus str. Delta H
O28438   285 GATITTK 291 Archaeoglobus fulgidus DSM 4304
Q58725   288 GVEITTK 294 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap