2P98


Conserved Protein Domain Family
met_pdase_I

?
TIGR00500: met_pdase_I 
Click on image for an interactive view with Cn3D
methionine aminopeptidase, type I
Methionine aminopeptidase is a cobalt-binding enzyme. Bacterial and organellar examples (type I) differ from eukaroytic and archaeal (type II) examples in lacking a region of approximately 60 amino acids between the 4th and 5th cobalt-binding ligands. This model describes type I. The role of this protein in general is to produce the mature form of cytosolic proteins by removing the N-terminal methionine. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129591
View PSSM: TIGR00500
Aligned: 9 rows
Threshold Bit Score: 373.992
Threshold Setting Gi: 489326401
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P98_A         2 ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQhAVSACLGYH------GYP---KSVCISI 72  Escherichia coli
P07906         3 ISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQhAVSACLGYH------GYP---KSVCISI 73  Escherichia coli
P53580        22 LVLLSARELDKMRRVGQLAANLLNHLESMVQPGVSTQALNDEATRWMEDHG-AISATLGYAp----pGYPpftGAICTSI 96  Synechocystis s...
O51132         4 LRLKSKDEIKKIKASASLLALTLLEVERNIVPGISTKELDLIAYDFIIKNR-AKPAFKGYR------GFK---GTICASV 73  Borrelia burgdo...
P56102         3 ISIKSPKEIKALRKAGELTAQALALLEREVRPGVSLLELDKMAEDFIKSSH-ARPAFKGLY------GFP---NSVCMSL 72  Helicobacter py...
Q01662       127 IPIYKKDQIKKIRKACMLGREVLDIAAAHVRPGITTDELDEIVHNETIKRG-AYPSPLNYY------NFP---KSLCTSV 196 Saccharomyces c...
P47418         2 IYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQKQ-AKCAFHGYL------GFP---GFNCLSL 71  Mycoplasma geni...
WP_003233698   1 MIVTNDQELEGLKKIGRIVALAREEMKRKAEPGMSTKDLDLIGKAVLDEHG-AVSAPEKEY------DFP---GVTCISV 70  Bacillales
O66489         3 IELYSQREIEKIRKASQIVAEVLHIVAENVKPGVSTWDLEMIARKETEKRG-AKPAFLGYKppfsdvRYP---AALCISI 78  Aquifex aeolicu...
2P98_A        73 NEVVCHGIPD-DaKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTIMGERLCRITQESLYLALR-MVKPGINLREIG 149 Escherichia coli
P07906        74 NEVVCHGIPDdA-KLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGK-PTIMGERLCRITQESLYLALR-MVKPGINLREIG 150 Escherichia coli
P53580        97 NEVVCHGIPNpK-QILKDGDIINIDVTLRLAGYHGDTSRTFLVGS-VSATARKLVEATQESMMRGIA-EIKPGARIGDIG 173 Synechocystis s...
O51132        74 NEEVIHGIPG-K-RKLADGDIVSIDCGVILDGFYSDMAKTFKVGN-VDSSIDKLLEVTNASLYKGIA-EMKVGNRILNIS 149 Borrelia burgdo...
P56102        73 NEVVIHGIPT-D-YVLQEGDIIGLDLGVEVDGYYGDSALTLPIGA-ISPQDEKLLACSKESLMHAIN-SIRVGMHFKELS 148 Helicobacter py...
Q01662       197 NEVICHGVPD-K-TVLKEGDIVNLDVSLYYQGYHADLNETYYVGEnISKEALNTTETSRECLKLAIK-MCKPGTTFQELG 273 Saccharomyces c...
P47418        72 NQTVIHGVAD-Q-TVFKDSDKLTLDIGIDYHGYLCDAAFTLLGNK-ADPKAVKLLNDVEQAFSKVIEpELFVNNPIGNLS 148 Mycoplasma geni...
WP_003233698  71 NDEVAHGIPStS-KILKAGDLVNIDISAEFGGFYSDTGISFVLGE-GEERLHKLCQCAENAFQKGLQ-QAKAGKRQNQIG 147 Bacillales
O66489        79 NDEVVHGLPKkE-KVIKEGDVVSIDFGAIYDGYAGDSAITVIAGK-GSPEAQKLLEATKEALYNAIE-KALPGKKVGDIT 155 Aquifex aeolicu...
2P98_A       150 AAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRET----NVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKT 224 Escherichia coli
P07906       151 AAIQKFVEAEGFSVVREYCGHGIGRGFHEEP-QVLHYDSRET----NVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKT 225 Escherichia coli
P53580       174 AAIQAYAEASGFSVVRDMVGHGIGRQMHTEL-QIPHYGKRGS----GLKLRPGMVFTVEPMLNEGTYELTFLADGWTVIT 248 Synechocystis s...
O51132       150 KAIEDYIKPFGFGIVREYTGHGVGFELHEEP-SVPNYYAPFFk---NIRIQEGMVLAIEPMVNLRGHKVSIKSDGWTVFA 225 Borrelia burgdo...
P56102       149 QILESTITERGFVPLKGFCGHGIGKKPHEEP-EIPNYLEKGVkpnsGPKIKEGMVFCLEPMVCQKQGEPKILADKWSVVS 227 Helicobacter py...
Q01662       274 DHIEKHATENKCSVVRTYCGHGVGEFFHCSP-NIPHYAKNRT----PGVMKPGMVFTIEPMINEGTWKDMTWPDDWTSTT 348 Saccharomyces c...
P47418       149 NAIQTYFENKGYFLVKEFGGHGCGIKIHEDP-LILNWGEKNQ----GVRLQEGMVICIEPMVMTDSSEITMAANNWNVLT 223 Mycoplasma geni...
WP_003233698 148 RAVYHEARSQGFTVIKTLTGHGIGRSLHEAPnHIMNYYDPFD----NALFKNGTVIALEPFISTKAETIVEAGDGWTFKT 223 Bacillales
O66489       156 KAIHETAEKYGFKTILRYGGHGVGRKVHQEP-FVPNNVKDIGk--kNPRLRQGMVIAIEPMLSIGTEETVEDGDGWTVKT 232 Aquifex aeolicu...
2P98_A       225 KDRSLSAQYEHTIVVTDNGCEILTLR 250 Escherichia coli
P07906       226 KDRSLSAQYEHTIVVTDNGCEILTLR 251 Escherichia coli
P53580       249 KDKKLSAQFEHTVVVTEEGVEILTLA 274 Synechocystis sp. PCC 6803 substr. Kazusa
O51132       226 SDLSYSAHFEHTVAVVDGLPLILSEV 251 Borrelia burgdorferi B31
P56102       228 VDGLNTSHHEHTIAIVGNKAVILTER 253 Helicobacter pylori 26695
Q01662       349 QDGKLSAQFEHTLLVTEHGVEILTAR 374 Saccharomyces cerevisiae S288c
P47418       224 LKSKFNCHVEQMYHITNNGFECLTN- 248 Mycoplasma genitalium G37
WP_003233698 224 PDKSMVAQVEHTIVITKDEPIILTKL 249 Bacillales
O66489       233 KDGSLAAHFEHTVAITKKGPVILTEL 258 Aquifex aeolicus VF5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap