1EK8


Conserved Protein Domain Family
frr

?
TIGR00496: frr 
Click on image for an interactive view with Cn3D
ribosome recycling factor
This model finds only eubacterial proteins. Mitochondrial and/or chloroplast forms might be expected but are not currently known. This protein was previously called ribosome releasing factor. By releasing ribosomes from mRNA at the end of protein biosynthesis, it prevents inappropriate translation from 3-prime regions of the mRNA and frees the ribosome for new rounds of translation. EGAD|53116|YHR038W is part of the frr superfamily. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129587
View PSSM: TIGR00496
Aligned: 9 rows
Threshold Bit Score: 236.972
Threshold Setting Gi: 1350904
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EK8_A        10 EVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFD-RSMSPAVEKAIMASDLG 88  Escherichia col...
P44307        10 QDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYYGAATPLRQLANVVAEDARTLAVTVFD-RSLISAVEKAILTSDLG 88  Haemophilus inf...
P74456         7 KDHMQKSVEATQRSFNTIRTGRANASLLDRITVEYYGAETPLKSLATIGTPDASTIVIQPFD-MGSIGTIEKAISLSDLG 85  Synechocystis s...
P56398        10 KDLMQKSIQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPWE-KNLLKEIERSIQEANIG 88  Helicobacter py...
O51147         9 DEKMNKVLLSLDNEYKTLRTGRISSNIFDRICIQYHDRRTPITQVSSIRIPEARLVVIQPWD-KSILNKIEQAILNSDLS 87  Borrelia burgdo...
P75161        11 KETADKKFQWLKEELSKIRTGRPNPKLFDNLLVESYGDRMPMVALAQIAVNPPREIVIKPFDvKNNINAIYSEIQRANLG 90  Mycoplasma pneu...
P47673        11 KQAADKKIQWLKEELTKIRTGRPNPKIFDNLLIESYGQKMPLISLAQVTINPPREIIIKPFDpKSNTNAIYSEIQRANIG 90  Mycoplasma geni...
WP_003231927  10 KEKMEKAIAAYQRELATVRAGRANPSLLDKVTVEYYGAQTPLNQLSSINVPEARMLVITPYD-KTAIGDIEKAILKADLG 88  Bacillales
P16174        10 EVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFD-RSMSPAVEKAIMASDLG 88  Escherichia coli
1EK8_A        89 LNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAI 168 Escherichia col...
P44307        89 LNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKVAVRNVRRDANDKIKALLKDKEISENEQHKAEEEIQKITDIYI 168 Haemophilus inf...
P74456        86 LTPNNDGKVIRLNIPPLTAERRKELVKVAGKLAEEGKVAIRNIRRDAVDEVRKQEKNSDISEDEARDLQEEIQKLTDQST 165 Synechocystis s...
P56398        89 VNPNNDGETIKLFFPPMTSEQRKLIAKDAKAMGEKAKVAVRNIRQDANNQVKKLEKDKEISEDESKKAQEQIQKITDEAI 168 Helicobacter py...
O51147        88 MNPSNDGSVIRIKVPNLTSERRQEIVKHAKKIAEEHKISTRNIRQDLNNKVKKQEKESEITEDCLKRILDDIQKSTDMYI 167 Borrelia burgdo...
P75161        91 VQPVIDGDKIRINFPPMTQESRLESIKQAKKVVEQIHQELRSVRRDTLQMIK---KDDHKDEDFEEFLKEEVEKVNKQYI 167 Mycoplasma pneu...
P47673        91 VQPVIDGEKIRVNFPQITQETRLENIKHVKKIIEQIYQELRVVRRDALQMIK---KDNHN-EDLENSLKAEIEKINKNYS 166 Mycoplasma geni...
WP_003231927  89 LTPTSDGNMIRIAIPALTEERRKELVKVVKKYAEEAKVAVRNVRRDANDDLKKLEKNGDITEDELRASTEDVQKLTDEYV 168 Bacillales
P16174        89 LNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAI 168 Escherichia coli
1EK8_A       169 KKIEAALADKEAELMQF 185 Escherichia coli BW2952
P44307       169 KKVDEVLADKEKELMDF 185 Haemophilus influenzae Rd KW20
P74456       166 KRIDELLAAKEKDITTV 182 Synechocystis sp. PCC 6803 substr. Kazusa
P56398       169 KKIDESVKNKEDAILKV 185 Helicobacter pylori 26695
O51147       168 KKIDSILESKIQEIMEA 184 Borrelia burgdorferi B31
P75161       168 AQLETIQKQKEKELLVV 184 Mycoplasma pneumoniae M129
P47673       167 NQLEEIQKDKEKELLTI 183 Mycoplasma genitalium G37
WP_003231927 169 SKIDSVTKDKEKEIMEV 185 Bacillales
P16174       169 KKIEAALADKEAELMQF 185 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap