Conserved Protein Domain Family
crcB

?
TIGR00494: crcB 
protein CrcB
The role of this protein is uncharacterized, but phenotypes associated with overproduction include resistance to camphor, suppression of a mukB chromosomal partition mutant, and chromosome condensation, together suggesting a function related to chromosome folding. [Unknown function, General]
Statistics
?
PSSM-Id: 129585
View PSSM: TIGR00494
Aligned: 5 rows
Threshold Bit Score: 106.702
Threshold Setting Gi: 18202581
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O25823   6 LWAALGGAIGSSLRYFVGKMMpSKFLMFesFPLGTFSVNIIGCFVIGF-MGHLAVKKVFGDDFGIFFVTGVLGGFTTFSS 84  Helicobacter pylori 2...
P37002   6 LAVFIGGGTGSVARWLLSMRF-NPLHQA--IPLGTLTANLIGAFIIGIgFAWFSRMTNIDPVWKVLITTGFCGGLTTFST 82  Escherichia coli K-12
Q58918   6 LLIGVGGFFGAIFRYLISG-I-VPVKFG--LPTGTLAVNLIGSFILGF-LLYCSLFAPIPTEYKLFIGTGFCGALTTFST 80  Methanocaldococcus ja...
O07590   4 AGIFIGGGLGAMLRFWLGNVI-TAKTKGlsLPIGILTVNILGALGLGI----FTGLHVANASVSLIIGTGFFGAFTTFST 78  Bacillus subtilis sub...
P72836   9 LAIILGAIPGALARYYATIFL--AGLFGndLPYATFLINFSGCVGMGLvVTLATQPALMSPDLRLLLAVGFLGSYTTFST 86  Synechocystis sp. PCC...
O25823  85 YGLDTLKLLQKSQYIEAVSYALGTNILGLTGVAIGWFLA 123 Helicobacter pylori 26695
P37002  83 FSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLF 121 Escherichia coli K-12
Q58918  81 FSYETFVLVDEGLLFKALLNILINVVGCLIMVYFGRVLA 119 Methanocaldococcus jannaschii DSM 2661
O07590  79 FSVETIQLLMAKRVKESILYIVLTLCGSLFAFWCGWTIT 117 Bacillus subtilis subsp. subtilis str. 168
P72836  87 YALEVTSLWRMGQLGQGVLYGLGSLGIGTIGVLLGSLIA 125 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap