Conserved Protein Domain Family

TIGR00494: crcB 
protein CrcB
The role of this protein is uncharacterized, but phenotypes associated with overproduction include resistance to camphor, suppression of a mukB chromosomal partition mutant, and chromosome condensation, together suggesting a function related to chromosome folding. [Unknown function, General]
PSSM-Id: 129585
Aligned: 5 rows
Threshold Bit Score: 106.702
Threshold Setting Gi: 18202581
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q58918  81 FSYETFVLVDEGLLFKALLNILINVVGCLIMVYFGRVLA 119 Methanocaldococcus jannaschii DSM 2661
O07590  79 FSVETIQLLMAKRVKESILYIVLTLCGSLFAFWCGWTIT 117 Bacillus subtilis subsp. subtilis str. 168
P72836  87 YALEVTSLWRMGQLGQGVLYGLGSLGIGTIGVLLGSLIA 125 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap