3B8W


Conserved Protein Domain Family
alr

?
TIGR00492: alr 
Click on image for an interactive view with Cn3D
alanine racemase
This enzyme interconverts L-alanine and D-alanine. Its primary function is to generate D-alanine for cell wall formation. With D-alanine-D-alanine ligase, it makes up the D-alanine branch of the peptidoglycan biosynthetic route. It is a monomer with one pyridoxal phosphate per subunit. In E. coli, the ortholog is duplicated so that a second isozyme, DadX, is present. DadX, a paralog of the biosynthetic Alr, is induced by D- or L-alanine and is involved in catabolism. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 129583
View PSSM: TIGR00492
Aligned: 9 rows
Threshold Bit Score: 487.632
Threshold Setting Gi: 6647402
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3B8W_A        22 QA-ATVVINRRALRHNLQRLR-ELAPASKMVAVVKANAYGHGLLETARTLPD--ADAFGVARLEEALRLRAGGITKPVLL 97  Escherichia col...
P29012         3 RP-IQASLDLQALKQNLSIVR-QAATHARVWSVVKANAYGHGIERIWSAIGA--TDGFALLNLEEAITLRERGWKGPILM 78  Escherichia col...
P29743         2 QA-ATVVINRRALRHNLQRLR-ELAPASKMVAVVKANAYGHGLLETARTLPD--ADAFGVARLEEALRLRAGGITKPVLL 77  Escherichia coli
P45257         4 KP-ATAKISSHALKQNLEIIK-QKAPNSKIIAVVKANAYGHGVVFVASTLEQn-VDCFGVARLEEALALRSNGITKPILL 80  Haemophilus inf...
P10725         8 RD-TWAEIDLSAIKENVSNMKkHIGEHVHLMAVVKANAYGHGDAETAKAALDagASCLAVAILDEAISLRKKGLKAPILV 86  Bacillus subtil...
P94494         6 RE-VWIEVNLDAVKKNLRAIRrHIPHKSKIMAVVKANGYGHGSIEVARHALEhgASELAVASVEEGIVLRKAGITAPILV 84  Bacillus subtil...
O51182         8 GSnKTIIINLNNLEHNLNLIKnKIGEK-EIVATLKGDAYGHGLINIFKFLKSknINYFGLSNIEDAKTLKKIDKNIKILM 86  Borrelia burgdo...
WP_010873738  31 RQrAWVEIDQAALVHNVRQFRqYVGPKTNLMAVVKADAYGHGAVRVAQTALQagADWLAIATLGEGIELREAGITAPILL 110 Synechocystis s...
O25595         3 KRaSFVEVDTASLRHNFSAVKsIVPKDACVMAVVKANAYGAGAIKASEIFLQegANYLGVATLDEALELRSHFSKTPILI 82  Helicobacter py...
3B8W_A        98 LEGFFdARDLPTISAQHFHTAVHNEEQLAALEEASLDEP----VTVWMXLDTGMHRLGVRPE-QAEAFYHRLTQCKNVRq 172 Escherichia col...
P29012        79 LEGFFhAQDLEIYDQHRLTTCVHSNWQLKALQNARLKAP----LDIYLKVNSGMNRLGFQPD-RVLTVWQQLRAMANVG- 152 Escherichia col...
P29743        78 LEGFFdARDLPTISAQHFHTAVHNEEQLAALEEASLDEP----VTVWMKLDTGMHRLGVRPE-QAEAFYHRLTQCKNVRq 152 Escherichia coli
P45257        81 LEGFFnEQDLPILAVNNIETVVHNHEQLDALKRANLPSP----IKVWLKIDTGMHRLGVALD-EVDYFYQELKKLPQIQp 155 Haemophilus inf...
P10725        87 LGAVP-PEYVAIAAEYDVTLTGYSVEWLQEAARHTKKGS----LHFHLKVDTGMNRLGVKTE-EEVQNVMAILDRNPRLk 160 Bacillus subtil...
P94494        85 LGFTS-LSCVKKSAAWNITLSAFQVDWMKEANEILEKEAsanrLAIHINVDTGMGRLGVRTK-EELLEVVKALKASKFLr 162 Bacillus subtil...
O51182        87 YIKVD-KKEIKNLIKFELVPFVSDFEYLFLIEKECALQKn--kIKVHLKIDIGMNRYGIKID--DALEIATYIQNSKFLe 161 Borrelia burgdo...
WP_010873738 111 LGGINsPEEIEAIAHWRLQPTLCSPEQAQLFNDILLKLGk--vLPVHLKLDTGMTRLGTPWP-QAANFVGLVQSLPQLR- 186 Synechocystis s...
O25595        83 LGYSP-NANASMLVDNDLSAMIFSLEQAEVFSQMALKSQk--rLKVHIKIDTGMHRLGLEPNfKSIETIKKIRALKGLE- 158 Helicobacter py...
3B8W_A       173 PVNIVSHFARADEPkcGATEKQLAIFNTFCEGKPGQ------RSIAASGGILLWPQSH----FDWVRPGIILYGVSPLPD 242 Escherichia col...
P29012       153 EMTLMSHFAEAEHP--DGISGAMARIEQAAEGLECR------RSLSNSAATLWHPEAH----FDWVRPGIILYGASPSGQ 220 Escherichia col...
P29743       153 PVNIVSHFARADEPkcGATEKQLAIFNTFCEGKPGQ------RSIAASGGILLWPQSH----FDWVRPGIILYGVSPLED 222 Escherichia coli
P45257       156 HLGFVSHFSRADELesDYTQLQINRFLSVTKDKQGE------RTIAASGGILFWPKSH----LECIRPGIIMYGISPTD- 224 Haemophilus inf...
P10725       161 CKGVFTHFATADEKerGYFLMQFERFKELIAPLPLKnl---mVHCANSAAGLRLKKGF----FNAVRFGIGMYGLRPSAD 233 Bacillus subtil...
P94494       163 WTGIFTHFSTADEPdtTLTKLQHEKFISFLSFLKKQgielptVHMCNTAAAIAFPEFS----ADMIRLGIGLYGLYPSAY 238 Bacillus subtil...
O51182       162 LEGICSHLPSIENFk--TTQKQIEQFLFFLETLKQKnihpkfVHISNSGHIINYKLNPq---FNMVRPGLILYGYCQSLK 236 Borrelia burgdo...
WP_010873738 187 LASLYSHLATADDPntATMLQQQERFAKAIASLRQArlpipkLHLANSAATLHGQAWH----YDMVRVGLGLYGLYPAP- 261 Synechocystis s...
O25595       159 IEGIFTHLSNADAKikTHAKNQMKAFNAFLEQLLDQkiefqyRHAYNSAGILSLCNGNenrlLNLYRPGIMLYGFYPSNG 238 Helicobacter py...
3B8W_A       243 RSTGADFGCQPVMSLTSSLIAVREHKAGE-PVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRV 321 Escherichia col...
P29012       221 WRDIANTGLRPVMTLSSEIIGVQTLKAGE-RVGYGGRYTARDEQRIGIVAAGYADGYPRHAPTGTPVLVDGVRTMTVGTV 299 Escherichia col...
P29743       223 RSTGADFGCQPVMSLTSSLIAVREHKAGE-PVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRV 301 Escherichia coli
P45257       225 -TIGKEFGLTPVMNLTSSLIAVRHHKQGD-PVGYGGIWTSPRDTKIGVVAMGYGDGYPRDVPEGTPVYLNGRLVPIVGRV 302 Haemophilus inf...
P10725       234 MSDEIPFQLRPAFTLHSTLSHVKLIRKGE-SVSYGAEYTAEKDTWIGTVPVGYADGWLRKLK-GTDILVKGKRLKIAGRI 311 Bacillus subtil...
P94494       239 IKQLNLVKLEPALSLKARIAYVKTMRTEPrTVSYGATYIAEPNEVIATLPIGYADGYSRALSNRGFVLHRGKRVPVAGRV 318 Bacillus subtil...
O51182       237 -NKKPALNFKPVLSLFSKVIFIKNVKKGE-KISYSGIFQAKEDMKIGIIPIGYFDGIPQNISNDFYFLINNKKCKIRGKV 314 Borrelia burgdo...
WP_010873738 262 -HLGDCLDLKPVLTVRAKITQIRTIPPGT-GVSYGHQFVSEETMPMAVVGIGYADGVPRNLSNQLEVLLRGQPVRQIGAI 339 Synechocystis s...
O25595       239 MKESCPTILKNVISLKAQIVQIRSVKKGE-FIGYGEHFYTNEETLVGVLALGYADGLMRALGNRIQVAINNQLAPLIGKV 317 Helicobacter py...
3B8W_A       322 AMDMICVDLGpQAQDKAGDPVILWG----EGLPVERIAEMTKVSAYELITRLTSRVAMKYV 378 Escherichia coli K-12
P29012       300 SMDMLAVDLTpCPQAGIGTPVELWG----KEIKIDDVAAAAGTVGYELMCALALRVPVVTV 356 Escherichia coli K-12
P29743       302 AMDMICVDLGpQAQDKAGDPVILWG----EGLPVERIAEMTKVSAYELITRLTSRVAMKYV 358 Escherichia coli
P45257       303 SMDMLTVDLGaDSQDLVGDEVILWG----KELPIETVAKFTGILSYELITKLTPRVITEYV 359 Haemophilus influenzae Rd KW20
P10725       312 CMDQFMVELDqEYPPGTKVTLIGRQg--dEYISMDEIAGRLETINYEVACTISSRVPRMFL 370 Bacillus subtilis subsp. subtilis ...
P94494       319 TMDMIMVSLGeNGEGKQGDEVVIYGkqkgAEISVDEVAEMLNTINYEVVSTLSRRIPRFYI 379 Bacillus subtilis subsp. subtilis ...
O51182       315 CMNLTIVEIPkDLKVKTGSKVEIVS----EKLSIDEMSKFSKRSHYELLCNIGKYEKRKYL 371 Borrelia burgdorferi B31
WP_010873738 340 TMDQMMVDLRgIDDPQVGEVVTLIGqdgdRQITADHWASTLGTISWEILCGFKHRLPRILI 400 Synechocystis sp. PCC 6803
O25595       318 CMDQCFVKLN-NIQAKEGDEVILFGdksaKANDASEIXALLNTIAYETISTLSKRLERVYI 377 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap