Conserved Protein Domain Family
aEF-2

?
TIGR00490: aEF-2 
translation elongation factor aEF-2
This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129581
View PSSM: TIGR00490
Aligned: 3 rows
Threshold Bit Score: 1358.8
Threshold Setting Gi: 3122056
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58448   3 KRAKMIAKIKELMEKYDRIRNIGICAHIDHGKTTLSDNLLAGAGMISKELAGEQLALDFDEEEAQRGITIFAANVSMVHT 82  Methanocaldococcus ja...
O28385   2 ARAKKVDKIKELMWKPKFIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGQQLYLDFDEQEQERGITINAANVSMVHE 81  Archaeoglobus fulgidu...
O27131   3 RRAKMISKIKELMYQPEYIRNIGIVAHIDHGKTTLSDNLLAGAGMISAELAGDQRFLDFDEQEQARGITIDAANVSMVHS 82  Methanothermobacter t...
Q58448  83 YEGNEYLINLIDTPGHVDFGGDVTRAMRAIDGAIVVVCAVEGVMPQTETVLRQALRERVKPVLFINKVDRLINELKLTPE 162 Methanocaldococcus ja...
O28385  82 YEGQDYLINLIDTPGHVDFGGDVTRAMRAVDGVIVVVDAVEGVMPQTETVLRQALKENVKPVLFVNKVDRLIKELELTPQ 161 Archaeoglobus fulgidu...
O27131  83 YEGNEYLINLIDTPGHVDFGGDVTRAMRAVDGAVVVVCAVEGIMPQTETVLRQALKENVRPVLFINKVDRLINELKLDAS 162 Methanothermobacter t...
Q58448 163 ELQSRFIKIINDINNLIRKMAPEEFkDKWLVRVEDGSVAFGSAYNNWAISVPFMKKSGITFKDIIKYCEEDRQDELAEKA 242 Methanocaldococcus ja...
O28385 162 QMQERLIKVITEVNKLIKAMRPDKY-SEWKIDVANGSAAFGSALYNWAVSVPSQKKTGIGFKEVYEHIKEGKVKELAKKS 240 Archaeoglobus fulgidu...
O27131 163 ELQERFVKIIANANKLIKNMAPEEFrDKWQVRVEDGSVAFGSAYHNWAINVPIMQETGINFNDIYKYCTEDNQKELAQKV 242 Methanothermobacter t...
Q58448 243 PLHEVVLDMVIKHLPSPPEAQKYRIPHLWKGDLNSEAGKAMLNCDPNGPLAGVITKIIVDKHAGAVSVCRLFSGRIKQGD 322 Methanocaldococcus ja...
O28385 241 PLYQVVLDMVIRHLPSPIEAQKERIAVIWKGDINSEVGKAMVNCDPKGPVALMITKIVVEPQAGEIAVGRLYSGTIRPGM 320 Archaeoglobus fulgidu...
O27131 243 PLHQVLLGMVVEHLPSPAESQAYRVPIIWSGDLESEEGQAMLKTDPEGPLAVMVTDVSIDKHAGEVATGRVYGGAIEKGS 322 Methanothermobacter t...
Q58448 323 EVYMVNNQQKAKIQQVSVFMGPERIPVDSISAGNICALVGLKEASAGETiCSPDKIIEPFEAITHISEPVITVAIEAKNT 402 Methanocaldococcus ja...
O28385 321 ELYIVDRKAKNRIQTVGLYMGPRRVEVDEIPAGNIVAVIGLKDAVAGST-CTTVENLTPFESIKHYSEPVVTMAIEAKNP 399 Archaeoglobus fulgidu...
O27131 323 EVFLVGSHSKARVQQVGVYMGPERVNTDKVPAGNIVAITGAKNAVAGETiCDTGRKIKAFEGLEHISEPVVTVAVEAKNT 402 Methanothermobacter t...
Q58448 403 KDLPKLIEVLRQVAREDPTVKVEINEETGEHLLSGMGELHIEIITKLKIERdAGIPVEVGQPIVVYRETVTGQSPVVESK 482 Methanocaldococcus ja...
O28385 400 RDLPKLIEVLRKLAKEDPTLHITLNEETGEHLISGMGELHLEVKVEKIRRD-YKLDVITSPPIVVFRETVTGTSPVVEGK 478 Archaeoglobus fulgidu...
O27131 403 KDLPKLIEVLRQVGKEDPTVRVEINEETGEHLISGMGELHLEIIAYRINEK--GVEIETSEPIVVYRETVAGTAGPVEGK 480 Methanothermobacter t...
Q58448 483 SPNKHNKLYFVVEPLEESVLQAYKEGrIPDVDTKRKlddKIVQELIKAGMDPEEAKRVMCIYEGNVLINMTRGIVHLDEV 562 Methanocaldococcus ja...
O28385 479 SPNKHNRFYIVVEPLPEKVIQMFKEG-VVDMKMDKK---ERRRLLQEAGLTSEEAAGAEEYYEGNLFCDVTKGIQYLNET 554 Archaeoglobus fulgidu...
O27131 481 SPNKHNRFYIEIEPVEASVMQAIQEGkIKEGRVKGK---EMAKNFIEAGMDKEEARRVWDVYEKNLFINMTRGIQYLDEI 557 Methanothermobacter t...
Q58448 563 KELIIQGFKEAMRNGPLAAEKCQGVKVKLMDAVLHEDAIHRGPAQMIPAARFGIRDAMMQANPVLLEPMQFVYINTPQDF 642 Methanocaldococcus ja...
O28385 555 MELILEGFREAMRAGPIAREPCMGIKVKLVDCKLHEDAVHRGPAQVIPAVRSAIFAAILQAKPALLEPYQKIFITVPQDM 634 Archaeoglobus fulgidu...
O27131 558 KELLMDGFESAMDNGPVAKEKVMGVKIKLMDAKIHEDAVHRGPAQVLPAIRKGIFGAMMSAEPVLLEPIQKVFINVPQDY 637 Methanothermobacter t...
Q58448 643 MGAAMREISNRRGQILDMEQEGDMAIIKAKCPVAEMFGFAGAIRGATQGRCLWSIEFAGYEKVPRDMQEQLIKQIRERKG 722 Methanocaldococcus ja...
O28385 635 MGAVTREIQGRRGQILEMKTEGDMVTIIAKAPVKEMFGFAGAIRGATSGKAIWSTEHAGFELVPQNLFQEFVMEVRKRKG 714 Archaeoglobus fulgidu...
O27131 638 MGSATREIQNRRGQIVNMTQEGDMVTVESTVPVAEMFGFAGDIRSATEGRCLWSTENAGFERLPNELQHTITREVRTRKG 717 Methanothermobacter t...
Q58448 723 LKLE 726 Methanocaldococcus jannaschii DSM 2661
O28385 715 LKLE 718 Archaeoglobus fulgidus DSM 4304
O27131 718 LSPE 721 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap