Conserved Protein Domain Family
aEF-1_beta

?
TIGR00489: aEF-1_beta 
translation elongation factor aEF-1 beta
This model describes the archaeal translation elongation factor aEF-1 beta. The member from Sulfolobus solfataricus was demonstrated experimentally. It is a dimer that catalyzes the exchange of GDP for GTP on aEF-1 alpha. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129580
View PSSM: TIGR00489
Aligned: 3 rows
Threshold Bit Score: 81.4712
Threshold Setting Gi: 3219799
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57901  1 MATVLAKIKIMPTSPEVNKEKLKEKIKEVLEKQdVAIRGLFDEPLAFGLYAIYTVIEMEEREGGTEPIENALAEIDEVES 80  Methanocaldococcus jan...
O27734  1 MGDVVATIKVMPESPDVDLEALKKEIQERIPEG-TELHKIDEEPIAFGLVALNVMVVVGDAEGGTEAAEESLSGIEGVSN 79  Methanothermobacter th...
O29681  1 MGSVMMKIRVMPSDVDVDLNEVLEKIKNIQMEG-VEIRDSAIQPIAFGLKAIVLMAVMPDMEGIGDRYIEEIGKIEGVES 79  Archaeoglobus fulgidus...
Q57901 81 VETVEVSLA 89  Methanocaldococcus jannaschii DSM 2661
O27734 80 IEVTDVRRL 88  Methanothermobacter thermautotrophicus str. Delta H
O29681 80 VEIEDMELL 88  Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap