1DG1


Conserved Protein Domain Family
EF-Tu

?
TIGR00485: EF-Tu 
Click on image for an interactive view with Cn3D
translation elongation factor TU
This model models orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts, one of several GTP-binding translation factors found by the more general pfam model GTP_EFTU. The eukaryotic conterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this model. EF-Tu is one of the most abundant proteins in bacteria, as well as one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129576
View PSSM: TIGR00485
Aligned: 11 rows
Threshold Bit Score: 723.875
Threshold Setting Gi: 1149571
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DG1_G         1 MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYG-GAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAH 79  Escherichia col...
P33166         1 MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGkGTAMAYDQIDGAPEERERGITISTAHVEYETETRHYAH 80  Bacillus subtil...
P23568         1 MAREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEGK-SAATRYDQIDKAPEEKARGITINSAHVEYSSDKRHYAH 79  Mycoplasma pneu...
P13927         1 MAREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEGK-SAATRYDEIDKAPEEKARGITINSAHVEYSSDKRHYAH 79  Mycoplasma geni...
P74227         1 MARAKFERTKDHVNIGTIGHVDHGKTTLTAAITMTLAELGG-AKARKYEDIDAAPEEKARGITINTAHVEYETDSRHYAH 79  Synechocystis s...
CAA61511      73 RSMATFTRNKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGK-AKAIAFDEIDKAPEEKKRGITIATAHVEYETAKRHYAH 151 thale cress
P56003         1 MAKEKFNRTKPHVNIGTIGHVDHGKTTLSAAISAVLSLKGL-AEMKDYDNIDNAPEEKERGITIATSHIEYETENRHYAH 79  Helicobacter py...
AAA19798       1 MSKETFQRNKPHINIGTIGHVDHGKTTLTAAITRALSGDGL-ADFRDYSSIDNTPEEKARGITINASHVEYETANRHYAH 79  Chlamydia trach...
WP_020237577   1 MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYG-GAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAH 79  Escherichia coli
WP_005667564   1 MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYG-GAARAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAH 79  Haemophilus inf...
P46280        71 AARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASLGN-SAPKKYDEIDAAPEERARGITINTATVEYETENRHYAH 149 soybean
1DG1_G        80 VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDE--ELL---------- 147 Escherichia col...
P33166        81 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLSKNVGVPYIVVFLNKCDMVDDE--ELL---------- 148 Bacillus subtil...
P23568        80 VDCPGHADYIKNMITGAAQMDGAILVVSATDSVMPQTREHILLARQVGVPRMVVFLNKCDIATDE--EVQ---------- 147 Mycoplasma pneu...
P13927        80 VDCPGHADYIKNMITGAAQMDGAILVVSATDSVMPQTREHILLARQVGVPKMVVFLNKCDIASDE--EVQ---------- 147 Mycoplasma geni...
P74227        80 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLAKQVGVPKLVVFLNKKDMVDDE--ELL---------- 147 Synechocystis s...
CAA61511     152 VDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMPQTKEHILLARQVGVPSLVCFLNKVDVVDDP--ELL---------- 219 thale cress
P56003        80 VDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLSRQVGVPHIVVFLNKQDMVDDQ--ELL---------- 147 Helicobacter py...
AAA19798      80 VDCPGHADYVKNMITGAAQMDGAILVVSATDGAMPQTKEHILLARQVGVPYIVVFLNKIDMISEEdaELV---------- 149 Chlamydia trach...
WP_020237577  80 VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDE--ELLtkscwnwlkw 157 Escherichia coli
WP_005667564  80 VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDE--ELL---------- 147 Haemophilus inf...
P46280       150 VDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAKQVGVPNIVVFLNKQDQVDDE--ELL---------- 217 soybean
1DG1_G       148 ---ELVEMEVRELLSQYDFPGDDTPIVRGSALKALE----------GDAEWEAKILELAGFLDSYIPEPERAIDKPFLLP 214 Escherichia col...
P33166       149 ---ELVEMEVRDLLSEYDFPGDDVPVVKGSALKALE----------GDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMP 215 Bacillus subtil...
P23568       148 ---ELVAEEVRDLLTSYGFDGKNTPIIYGSALKALE----------GDPKWEAKIHDLMNAVDEWIPTPEREVDKPFLLA 214 Mycoplasma pneu...
P13927       148 ---ELVAEEVRDLLTSYGFDGKNTPIIYGSALKALE----------GDPKWEAKIHDLIKAVDEWIPTPTREVDKPFLLA 214 Mycoplasma geni...
P74227       148 ---ELVELEVRELLSDYDFPGDDIPIVAGSALKAIE----------GEKEYKDAILELMKAVDDYIDTPEREVDKPFLMA 214 Synechocystis s...
CAA61511     220 ---ELVEMELRELLSFYKFPGDDIPIIRGSALSALQg--------tNDEIGRQAILKLMDAVDEYIPDPVRVLDKPFLMP 288 thale cress
P56003       148 ---ELVEMEVRELLSAYEFPGDDTPIVAGSALRALEeak-----agNVGEWGEKVLKLMAEVDAYIPTPERDTEKTFLMP 219 Helicobacter py...
AAA19798     150 ---DLVEMELAELLEEKGYKG--CPIIRGSALKALE----------GDAAYIEKVRELMQAVDDNIPTPEREIDKPFLMP 214 Chlamydia trach...
WP_020237577 158 kfvELVEMEVRELLSQYDFPGDDTPIVRGSALKALE----------GDAEWEAKILELAGFLDSYIPEPERAIDKPFLLP 227 Escherichia coli
WP_005667564 148 ---ELVEMEVRELLSQYDFPGDDTPIVRGSALQALN----------GVAEWEEKILELANHLDTYIPEPERAIDQPFLLP 214 Haemophilus inf...
P46280       218 ---QLVELEVRELLSKYEFPGDDVPIISGSALLSLEalmanpsikrGENQWVDKIYELMEAVDDYIPIPQRQTELPFLLA 294 soybean
1DG1_G       215 IEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIK---ETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQ 291 Escherichia col...
P33166       216 VEDVFSITGRGTVATGRVERGQVKVGDEVEIIGLQe--ENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQ 293 Bacillus subtil...
P23568       215 IEDTMTITGRGTVVTGRVERGELKVGQEIEIVGLR---PIRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVDRKEVERGQ 291 Mycoplasma pneu...
P13927       215 IEDTMTITGRGTVVTGRVERGELKVGQEVEIVGLK---PIRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVERKEVERGQ 291 Mycoplasma geni...
P74227       215 VEDVFSITGRGTVATGRIERGKVKVGEEISIVGIK---DTRKATVTGVEMFQKTLEEGMAGDNVGLLLRGIQKEDIERGM 291 Synechocystis s...
CAA61511     289 IEDVFSIQGRGTVATGRIEQGVIKVGEEVEILGLReggCSTKSTVTGVEMFKKILDNGQAGDNVGLLLRGLKREDIQRGM 368 thale cress
P56003       220 VEDVFSIAGRGTVVTGRIERGVVKVGDEVEIVGIR---PTQKTTVTGVEMFRKELEKGEAGDNVGVLLRGTKKEEVERGM 296 Helicobacter py...
AAA19798     215 IEDVFSISGRGTVVTGRIERGIVKVSDKVQLVGLR---DTKETIVTGVEMFRKELPEGRAGENVGLLLRGIGKNDVERGM 291 Chlamydia trach...
WP_020237577 228 IEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIK---ETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQ 304 Escherichia coli
WP_005667564 215 IEDVFSISGRGTVVTGRVERGIIRTGDEVEIVGIK---DTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQ 291 Haemophilus inf...
P46280       295 IEDVFTITGRGTVATGRVERGTIRVGETVDIVGVK---DTRNTTVTGVEMFQKILDEALAGDNVGLLLRGIQKTDIQRGM 371 soybean
1DG1_G       292 VLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEG-----VEMVMPGDNIKMVVTLIHP 366 Escherichia col...
P33166       294 VLAKPGTITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEG-----VEMVMPGDNTEMNVELIST 368 Bacillus subtil...
P23568       292 VLAKPGSIKPHKKFKAEIYALKKEEGGRHTGFLNGYRPQFYFRTTDVTGSISLPEN-----TEMVLPGDNTSITVELIAP 366 Mycoplasma pneu...
P13927       292 VLAKPGSIKPHKKFKAEIYALKKEEGGRHTGFLNGYRPQFYFRTTDVTGSIALAEN-----TEMVLPGDNASITVELIAP 366 Mycoplasma geni...
P74227       292 VLAKPGSITPHTEFEGEVYVLKKEEGGRHTPFFANYRPQFYVRTTDVTGTIKSYTAddgsaVEMVMPGDRIKMTVELINP 371 Synechocystis s...
CAA61511     369 VIAKPGSCKTYKKFEAEIYVLTKDEGGRHTAFFSNYRPQFYLRTADITGKVELPEN-----VKMVMPGDNVTAVFELIMP 443 thale cress
P56003       297 VLCKPGSITPHKKFEGEIYVLSKEEGGRHTPFFTNYRPQFYVRTTDVTGSITLPEG-----VEMVMPGDNVKITVELISP 371 Helicobacter py...
AAA19798     292 VVCLPNSVKPHTQFKCAVYVLQKEEGGRHKPFFTGYRPQFFFRTTDVTGVVTLPEG-----VEMVMPGDNVEFEVQLISP 366 Chlamydia trach...
WP_020237577 305 VLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEG-----VEMVMPGDNIKMVVTLIHP 379 Escherichia coli
WP_005667564 292 VLAKPGSITPHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEG-----VEMVMPGDNIKMTVSLIHP 366 Haemophilus inf...
P46280       372 VLAKPGTITPHTKFSAIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGKVTEIMNdkdeeSKMVMPGDRVKLVVELIVP 451 soybean
1DG1_G       367 IAMDDGLRFAIREGGRTVGAGVVAKVLS 394 Escherichia coli K-12
P33166       369 IAIEEGTRFSIREGGRTVGSGVVSTITE 396 Bacillus subtilis subsp. subtilis str. 168
P23568       367 IACEKGSKFSIREGGRTVGAGSVTEVLE 394 Mycoplasma pneumoniae M129
P13927       367 IACEKGSKFSIREGGRTVGAGTVTEVLE 394 Mycoplasma genitalium G37
P74227       372 IAIEQGMRFAIREGGRTIGAGVVSKILK 399 Synechocystis sp. PCC 6803 substr. Kazusa
CAA61511     444 VPLETGQRFALREGGRTVGAGVVSKVMT 471 thale cress
P56003       372 VALELGTKFAIREGGRTVGAGVVSNIIE 399 Helicobacter pylori 26695
AAA19798     367 VALEEGMRFAIREGGRTIGAGTISKIIA 394 Chlamydia trachomatis
WP_020237577 380 IAMDDGLRFAIREGGRTVGAGVVAKVLS 407 Escherichia coli
WP_005667564 367 IAMDQGLRFAIREGGRTVGAGVVAKIIK 394 Haemophilus influenzae
P46280       452 VACEQGMRFAIREGGKTVGAGVIQSIIE 479 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap