2RDO


Conserved Protein Domain Family
EF-G

?
TIGR00484: EF-G 
Click on image for an interactive view with Cn3D
translation elongation factor EF-G
After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129575
View PSSM: TIGR00484
Aligned: 7 rows
Threshold Bit Score: 1191.92
Threshold Setting Gi: 3915665
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2RDO_7         1 MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVH--DGA-ATMDWMEQEQERGITITSAATTAFWSGmak 77  Escherichia coli
P75544         1 MARTVDLINFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETH--DGE-SVMDWMEQEKERGITITSAATSVSWKN--- 74  Mycoplasma pneu...
O30913         1 ----MDYNKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKgkDGVgATMDSMELERERGITIASAATHVEWKD--- 73  Borrelia burgdo...
P47335         1 MSRTVDLKNFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETH--DGE-SVMDWMEQEKERGITITSAATSVSWKN--- 74  Mycoplasma geni...
WP_000101814   1 MARKTPLNRIRNIGIAAHIDAGKTTTSERILFYTGVSHKIGEVH--DGA-ATMDWMEQEKERGITITSAATTCFWKD--- 74  Helicobacter py...
WP_010869011   1 MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVH--DGA-ATMDWMEQEQERGITITSAATTAFWSGmsq 77  Haemophilus inf...
BAA11003       1 MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETH--EGA-SQMDWMEQEQERGITITSAATTAQWKG--- 74  Bacillus subtil...
2RDO_7        78 qyepHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQ 157 Escherichia coli
P75544        75 ----CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRIIFVNKMDKTGANFERSVQS 150 Mycoplasma pneu...
O30913        74 ----FPINIIDTPGHVDFTIEVERSLRVLDGAILVLDSVAGVQSQSITVDRQLKRYSVPRLAFVNKCDKTGANPYNVKDQ 149 Borrelia burgdo...
P47335        75 ----CSLNLIDTPGHVDFTVEVERSLRVLDGAIAVLDAQMGVEPQTETVWRQASRYEVPRVIFVNKMDKTGANFERSVLS 150 Mycoplasma geni...
WP_000101814  75 ----HQINLIDTPGHVDFTIEVERSMRVLDGAVSVFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVENQ 150 Helicobacter py...
WP_010869011  78 qfpqHRINVIDTPGHVDFTVEVERSMRVLDGAVMVYCAVGGVQPQSETVWRQANKYEVPRIAFVNKMDRTGANFLRVVEQ 157 Haemophilus inf...
BAA11003      75 ----YRVNIIDTPGHVDFTVEVERSLRVLDGAVAVLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGT 150 Bacillus subtil...
2RDO_7       158 IKTRLGANPVPLQLAIGAEEHFTGVVDLVKMKAINWNdADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKY 237 Escherichia coli
P75544       151 IQQRLGVKAVPIQLPIGAENDFNGIIDLIEEKVYFFD-GGKEEKAEEKPIPDQFKDQVKQMRAHLVEEVANFDDQLMADY 229 Mycoplasma pneu...
O30913       150 LRSKLDLNSVLMQIPIGLEDKHIGVIDLVLMKAYYFE-GKDGTEIIEKEIPSDLLEEAKSKREIMLDTLADFNDELMELH 228 Borrelia burgdo...
P47335       151 IQQRLGVKAVPIQFPIGAENDFNGIIDIITKKAYFFD-GNKEENAIEKPIPEQYVDQVEKLYNNLVEEVASLDDQLMADY 229 Mycoplasma geni...
WP_000101814 151 IKLRLKANPVPINIPIGAEDTFIGVIDLVQMKAIVWNnETMGAKYDVEEIPSDLLEKAKEYREKLVEAVAEQDEALMEKY 230 Helicobacter py...
WP_010869011 158 LKTRLGANAIPLQLPVGAEENFTGVVDLIKMKAINWNeADQGMTFTYEEVPANMQADCEEWRQNLVEAAAEASEELMEKY 237 Haemophilus inf...
BAA11003     151 LRDRLQANAHAIQLPIGAEDNFEGIIDLVENVAYFYE-DDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELDEELMDKY 229 Bacillus subtil...
2RDO_7       238 LGGEELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILDDgkDTPAERHASDDEPF 317 Escherichia coli
P75544       230 LEGKEISIADIKRCIRKGVIGCQFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPQAKAYGED--GNEVLISASDDAPF 307 Mycoplasma pneu...
O30913       229 MEGKEVPTEIIYNATRTGTLALKLCPVFMGSAYKNKGVQLLLDAVTRFLPSPHDIKN-TALDLNnnEKEIDLKIDNELPT 307 Borrelia burgdo...
P47335       230 LDGKPIEIDAIKNAIRNGVIHCKFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPPAKAIDAN--NKEISIKASDDANF 307 Mycoplasma geni...
WP_000101814 231 LGGEELSIEEIKKGIKAGCLNMSLVPMLCGSSFKNKGVQTLLDAVIDYLPAPTEVVDIKGIDPKt-EEEVFVKSSDDGEF 309 Helicobacter py...
WP_010869011 238 LGGEDLTEEEIKSALRQRVLANEIILVTCGSAFKNKGVQAMLDAVVEYLPAPTDIPAIKGINPD--ETEGERHASDEEPF 315 Haemophilus inf...
BAA11003     230 LEGEELTIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAPTDVAAIKGTRPDt-NEEIERHSSDEEPF 308 Bacillus subtil...
2RDO_7       318 SALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTL 397 Escherichia coli
P75544       308 VGLAFKVATDPFVGRLTFVRVYSGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIEEIRAGDICAIIGLKDTTTGETL 387 Mycoplasma pneu...
O30913       308 VALAFKLEDGQYG-QLTYVRIYQGILKKGQELINSRTSKKFKVGRLIRMHANNTEDIEFGGSGDIVALFGIECAS-GDTF 385 Borrelia burgdo...
P47335       308 IGLAFKVATDPFVGRLTFIRVYAGVLKSGSYVKNVRKNKKERVSRLVKMHAQNRNEIDEIRAGDICAVIGLKDTTTGETL 387 Mycoplasma geni...
WP_000101814 310 AGLAFKIMTDPFVGQLTFVRVYRGKLESGSYVYNSTKDKKERVGRLLKMHSNKREDIKEVYAGEICAFVGLKDTLTGDTL 389 Helicobacter py...
WP_010869011 316 SSLAFKIATDPFVGNLTFFRVYSGVINSGDTVLNSVRQKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTL 395 Haemophilus inf...
BAA11003     309 SALAFKVMTDPYVGKLTFFRVYSGTLDSGSYVKNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTL 388 Bacillus subtil...
2RDO_7       398 CDPDAPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREF 477 Escherichia coli
P75544       388 VDDKIDVQLEAMQFAQPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFTDPETGQTIIAGMGELHLDILVDRMRREF 467 Mycoplasma pneu...
O30913       386 CDPSINYSMTSMFIPDPVISLSVKPKDKKSADNMAKALGRFTKEDPTFKTYVDIESNETIIQGMGELHLEVYIERMKREF 465 Borrelia burgdo...
P47335       388 TDDKLDVQLEAMQFAEPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAGMGELHLDILVDRMKREF 467 Mycoplasma geni...
WP_000101814 390 CDEKNAVVLERMEFPEPVIHIAVEPKTKADQEKMGVALGKLAEEDPSFRVMTQEETGQTLIGGMGELHLEIIVDRLKREF 469 Helicobacter py...
WP_010869011 396 CAIDAPIILERMEFPEPVISVAVEPKTKADQEKMGLALGRLAQEDPSFRVHTDEESGETIISGMGELHLDIIVDRMKREF 475 Haemophilus inf...
BAA11003     389 CDEKDLVILESMEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLDIIVDRMKREF 468 Bacillus subtil...
2RDO_7       478 NVEANVGKPQVAYRETIRQKVTdVEGKHAKQSGGRGQYGHVVIDMYPLEpgsnP--K--GYEFINDIKGGVIPGEYIPAV 553 Escherichia coli
P75544       468 KVEVNVGAPQVSFRETFNKESE-VEGKYIKQSGGRGQYGHVKIRFEPNK----D--K--GFEFVDKIVGGRIPREYIKPV 538 Mycoplasma pneu...
O30913       466 KAEVETGMPQVAYRETITRKAE-FNYTHKKQSGGAGQFGRVAGFMEPLD----KegE--TYEFVNLIKGGVIPTEYIPSC 538 Borrelia burgdo...
P47335       468 KVEVNIGAPQVSFRETFKSTSE-VEGKYIKQSGGRGQYGHVKIRFEPNK----D--K--GFEFVDKIVGGRIPREYIKPV 538 Mycoplasma geni...
WP_000101814 470 KVEAEIGQPQVAFRETIRSSVS-KEHKYAKQSGGRGQYGHVFIKLEPKE----P--Gs-GYEFVNEISGGVIPKEYIPAV 541 Helicobacter py...
WP_010869011 476 KVEANIGKPQVSYRETIRTRVNdVEGKHAKQSGGRGQYGHVVIDLYPLD----P--EgpGYEFVNEIKGGVIPGEYIPAV 549 Haemophilus inf...
BAA11003     469 KVEANVGAPQVAYRETFRTGAK-VEGKFVRQSGGRGQFGHVWIEFEPNE----E--Ga-GFEFENAIVGGVVPREYIPAV 540 Bacillus subtil...
2RDO_7       554 DKGIQEQLKAGPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIAFKEGFKKAKPVLLEPIMKVEVETPEENTGDVIG 633 Escherichia coli
P75544       539 QAGLENAMASGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKVCSPVLLEPIMAIEVTVPEQYFGDTMG 618 Mycoplasma pneu...
O30913       539 DKGFQKAMERGTLIGFPIVDIKITINDGQYHIVDSSDIAFQLAAIGAFREAYEKAKPTILEPIMKVTLEGPTEFQGNMFG 618 Borrelia burgdo...
P47335       539 QTGLENAMNSGPLAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKQCNPVLLEPIMAIEVTVPEQYFGDTMG 618 Mycoplasma geni...
WP_000101814 542 DKGIQEAMQNGVLAGYPVVDFKVTLYDGSYHDVDSSEMAFKIAGSMAFKEASRAANPVLLEPMMKVEVEVPEEYMGDVIG 621 Helicobacter py...
WP_010869011 550 DKGIQEQLKSGPLAGYPVVDLGVRLHFGSYHDVDSSELAFKLAASLAFKAAFSKANPVLLEPIMKVEVETPPEYVGDVIG 629 Haemophilus inf...
BAA11003     541 QAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSNEMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMG 620 Bacillus subtil...
2RDO_7       634 DLSRRRGMLKGQESEVTGVKIHAEVPLSEMFGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVIEARG 703 Escherichia coli
P75544       619 DISSRRGLIEGTEQRDNVQVIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIATKK 688 Mycoplasma pneumoniae M129
O30913       619 LLNQRRGIITGSLEDGSFSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPSTIFDELRKKFN 688 Borrelia burgdorferi B31
P47335       619 DISSRRGIIEGTEQRDNVQLIKAKVPLKEMFGYATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIANKK 688 Mycoplasma genitalium G37
WP_000101814 622 DLNRRRGQINSMDDRLGLKIVNAFVPLVEMFGYSTDLRSATQGRGTYSMEFDHYGEVPSNIAKEIVEKRK 691 Helicobacter pylori
WP_010869011 630 DLSRRRAMVNGQEANEFVVKIYAEVPLSEMFGYATDLRSQTQGRASYSMEPLKYAEAPTSVAAAVIEARK 699 Haemophilus influenzae
BAA11003     621 DITSRRGRVEGMEARGNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYGEVPKSVAEEIIKKNK 690 Bacillus subtilis subsp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap