1F60


Conserved Protein Domain Family
EF-1_alpha

?
TIGR00483: EF-1_alpha 
Click on image for an interactive view with Cn3D
translation elongation factor EF-1 alpha
This model represents the counterpart of bacterial EF-Tu for the Archaea (aEF-1 alpha) and Eukaryotes (eEF-1 alpha). The trusted cutoff is set fairly high so that incomplete sequences will score between suggested and trusted cutoff levels. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129574
View PSSM: TIGR00483
Aligned: 5 rows
Threshold Bit Score: 744.76
Threshold Setting Gi: 3122061
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1F60_A   1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKF 80  Saccharomyces cerevis...
Q57770   1 MAKQKPVLNVAFIGHVDAGKSTTVGRLLYDSGAIDPQLLEKLKREAQERGKAGFEFAYVMDNLKEERERGVTIDVAHKKF 80  Methanocaldococcus ja...
O29325   1 MAKEKEHINVAFIGHVDHGKSTLIGRLLYETGEIPEHIIEKMRKEAQEKGKATFEFAWVMDRLKEERERGVTIDVAHRKF 80  Archaeoglobus fulgidu...
O27132   1 MAKEKEHMNLAFIGHVDHGKSTLVGHLLLQAGAIAEQQLA----EGEDK------FRFVMDRLSEERERGVTIDLAHAKF 70  Methanothermobacter t...
P02994   1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKF 80  Saccharomyces cerevis...
1F60_A  81 ETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEagisKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW 160 Saccharomyces cerevis...
Q57770  81 ETQKYEVTIVDCPGHRDFIKNMITGASQADAAVLVVDVNDAKTG----IQPQTREHMFLARTLGIKQIAVAINKMDTVNY 156 Methanocaldococcus ja...
O29325  81 QTDKYYITIVDCPGHRDFIKNMITGASQADAAVLVMDVVEK-------VQPQTREHIFLARTLGINQIIVAINKMDRVNY 153 Archaeoglobus fulgidu...
O27132  71 ETDKYEFTIVDCPGHRDFVKNMITGASQADAAVLVVAVDDG-------VMPQTKEHVFLSRTLGINQLIVAINKMDLVNY 143 Methanothermobacter t...
P02994  81 ETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEagisKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW 160 Saccharomyces cerevis...
1F60_A 161 DESRFQEIVKETSN-FIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYkgweketkagvvK------------GKTLL 227 Saccharomyces cerevis...
Q57770 157 SQEEYEKMKKMLSEqLLKVLGYNPDQIDFIPTASLKGDNVVKRSENMPWY------------K------------GPTLV 212 Methanocaldococcus ja...
O29325 154 DQKEYEAAKEAVSK-LLKMVGYKVDEIPFIPVSAYYGDNVAKKSDKTPWY------------N------------GPTLL 208 Archaeoglobus fulgidu...
O27132 144 DEEKFNALKDEVAA-LIKTVGYKPSDVEFIPLSAFEGDNITSKSENTPWY------------K------------GKTLV 198 Methanothermobacter t...
P02994 161 DESRFQEIVKETSN-FIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWY------------KgweketkagvvkGKTLL 227 Saccharomyces cerevis...
1F60_A 228 EAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVG 307 Saccharomyces cerevis...
Q57770 213 EALDKFQPPEKPTNLPLRIPIQDVYSITGVGTVPVGRVETGILRPGDKVVFEPAGVSGEVKSIEMHHEQIPQAEPGDNIG 292 Methanocaldococcus ja...
O29325 209 EAFDLLKPPEKLVDKPLRIPIQDVYSISGVGTVPVGRVESGVLRVGDKVVFEPAGVSGEVKSIEMHHEPIQEAYPGDNIG 288 Archaeoglobus fulgidu...
O27132 199 EALDDLEAPEKPVDLPLRIPIQDVYSITGVGTVPVGRVETGVLKKGENVIFEPAGVSGEVKSIEMHHEMIEQAEPGDNIG 278 Methanothermobacter t...
P02994 228 EAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVG 307 Saccharomyces cerevis...
1F60_A 308 FNVKNVSVKEIRRGNVCGDAKNdPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLED 387 Saccharomyces cerevis...
Q57770 293 FNVRGVSKKDIKRGDVCGHPDN-PPTVAEEFTAQIVVLQHPTAITVGYTPVFHAHTAQVACTFIELLKKLDPRTGQVIEE 371 Methanocaldococcus ja...
O29325 289 FNVRGVSKKDIRRGDVAGHPDN-PPTVVKDFTAQLVVLQHPTAITVGYTPVVHAHTAQIACRFVELQKKIDPRTGQVKEE 367 Archaeoglobus fulgidu...
O27132 279 FNVRGVGKNDIRRGDVAGHLDN-PPKVAKEFTAQIVVLQHPGVITVGYTPVFHCHTAQVACTFLELVQKMNPATGQVEEE 357 Methanothermobacter t...
P02994 308 FNVKNVSVKEIRRGNVCGDAKNdPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLED 387 Saccharomyces cerevis...
1F60_A 388 HPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE 443 Saccharomyces cerevisiae S288c
Q57770 372 NPQFLKTGDAAIVKIKPTKPMVIENVREIPQLGRFAIRDMGMTIAAGMAIDVKAKN 427 Methanocaldococcus jannaschii DSM 2661
O29325 368 NPQFLKTGDAAIVKLEPTRPMVIERVKDIPPMGRFAIRDMGMTIGAGMVLDLTPRK 423 Archaeoglobus fulgidus DSM 4304
O27132 358 NPDFLKTGNAAVVKVKPTKPLVIEKIKDIPHMGRFAIRDMGQTVAAGMCIDLVPAK 413 Methanothermobacter thermautotrophicus str. D...
P02994 388 HPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTE 443 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap