2BH2


Conserved Protein Domain Family
rumA

?
TIGR00479: rumA 
Click on image for an interactive view with Cn3D
23S rRNA (uracil-5-)-methyltransferase RumA
This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family. The member from E. coli has now been shown to act as the 23S RNA methyltransferase for the conserved U1939. The gene is now designated rumA and was previously designated ygcA. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129571
View PSSM: TIGR00479
Aligned: 6 rows
Threshold Bit Score: 634.553
Threshold Setting Gi: 62738954
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BH2_A        24 LDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRS 103 Escherichia col...
WP_003233892  20 LTHEGAGVAKVQGFPIFVPNALPEEKAQIKVTRVKKGFAFGRLIELKEESPHRTDAPCPIYKQCGGCQLQHMTYEGQLLF 99  Bacillus subtilis
WP_029317479  25 LGINGEGVGYFKKKVVFVPGALPGEEVVVQATKVQPKFSEGRIKKIRKASEHRVAPPCPVYEQCGGCQLQHLAYSQQLRE 104 Bacillus subtilis
WP_010872035  26 LNHQGEGIGRFNERVVFVPDTAPGDRLEVRLVKVKRNYALAQLLKILEPSVQRTRPSCIVADKCGGCQWQHLDYQFQVES 105 Synechocystis s...
WP_001413792  24 LDSFGQGVARHNGKTLFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRS 103 Escherichia coli
P44643        24 LDYQGLGVAKINGKTWFIENALPHEKVECRILEDKRQYGHAIVKKWRVKSPERLEPKCAHFMRCGGCQGQHIPIEMQRKA 103 Haemophilus inf...
2BH2_A       104 Ks---AALARLMKHDVSEVIADVP-------WGYRRRARLSLNYLPKTqqLQMGFRKAGSSDIVDVKQCPILAPQLEALL 173 Escherichia col...
WP_003233892 100 KqkqvKDVLERIGKLDLSKVTVHPtlgmedpWNYRNKAQVPVGEREGG--LVAGFYQQRSHDIIDMSACLIQQSKNDEAV 177 Bacillus subtilis
WP_029317479 105 KrdivIQSLERHTKFKVENMEIKEtigmdnpWNYRNKSQFQIGRSQSGs-IIAGLYGLDSHDIVPIKDCIVQHPATNKTT 183 Bacillus subtilis
WP_010872035 106 KqqqiIDALERIGGFTTLPLEPLLqsp--asLGYRNKATYPLSRSKTGq-VQAGYYRKGSHRLVNINQCPVQDDRLNLLL 182 Synechocystis s...
WP_001413792 104 Ks---AALARLMKHDVSEVIADVP-------WGYRRRARLSLNYLPKTqqLQMGFRKAGSSDIVDVKQCPILAPQLEALL 173 Escherichia coli
P44643       104 Ke---SALFKRLSKLQSEPISFQPmic-gdaWAYRRRVRLSLWFNPSTkqIEMGFRQKNTNDLIPVQSCEVAEPAINYLL 179 Haemophilus inf...
2BH2_A       174 PKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDs----------------- 236 Escherichia col...
WP_003233892 178 QAVKDICANYGVKAYNEERHKGWLRHIMVRYGVVTGEMMIVFITRTSDFPHKAKIIEDITAQfphvksivqninpnktnv 257 Bacillus subtilis
WP_029317479 184 GIVRRILEDFNVSVYNERKRKGDVRTIVTRVGFETGEVQVVLVTAKETLPHKEEIVKAIQKRlpevksiiqnvngaktsv 263 Bacillus subtilis
WP_010872035 183 TEVKKDIENRGWSIYDEEKKQGKLRHLSLRIGQRTGEMLLTLISAHKGLPDLEEQAGEWLERypdlggiclniqpepnnr 262 Synechocystis s...
WP_001413792 174 PKVRACLGSLQAMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDs----------------- 236 Escherichia coli
P44643       180 PKLTALLEKFSAPKQLGHIELVAADNGVAMLLRYTKNLAEIDRTLLLKFAEQEKLMLFLQSD------------------ 241 Haemophilus inf...
2BH2_A       237 ---EILETVSGEMPWYD-SNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVV 312 Escherichia col...
WP_003233892 258 ifgNETNVIWGEEYIYDlIGDVKFAISARSFYQVNPEQTKVLYDKALEYAELQGEETVIDAYCGIGTISLFLAKQAKKVY 337 Bacillus subtilis
WP_029317479 264 ifgEKTKQLAGKTVIQEvLGDVSFELSARAFFQLNPEQTVKLYDEVKKAAQLTGKEKVVDAYCGVGTIGMWVADGAKEVR 343 Bacillus subtilis
WP_010872035 263 ifgDETVVIAGRGICREkFADLSFSLGANTFFQVNSGAAELLLTRLQQALNLQGAELLVDAYAGVGTFTLPLARQVRQAI 342 Synechocystis s...
WP_001413792 237 ---EILETVSGEMPWYD-SNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVV 312 Escherichia coli
P44643       242 ---KGIEQIYGDAPYYQfSDGIKLHFDIRDFIQVNSALNEPMVNTALDWLELSQQDCVLDLFCGMGNFTLPLAKRVKSAV 318 Haemophilus inf...
2BH2_A       313 GVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAG-AAGVMQQIIKLEPIRIVYVSCNP 391 Escherichia col...
WP_003233892 338 GVEIVPEAIEDAKRNAELNGNTNAEFAVGEAETVIPKWYEEGITADTLVVDPPRKGcDEALLRTIVEMKPKRVVYVSCNP 417 Bacillus subtilis
WP_029317479 344 GMDVIKESIDDAKKNAKKHGMANATYVTGTAEHWLPKWTKEGFRPDVVIVDPPRTGcDSTFLDTIKKVKPKRFVYVSCNP 423 Bacillus subtilis
WP_010872035 343 AIEVNQDSVHQGQRNAEINQIANVDFLAGTVETVLPTLSE---IPDVLLLDPPRKGcAPEVLREIIRQRPEKIAYISCQP 419 Synechocystis s...
WP_001413792 313 GVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAG-AAGVMQQIIKLEPIRIVYVSCNP 391 Escherichia coli
P44643       319 GIEGVFEMVQKAAQNAERNQIKNIEFFQADLDQSFVEQPWANQSFNKILLDPPRSG-AAFALNALCELKAEKILYVSCNP 397 Haemophilus inf...
2BH2_A       392 ATLARDSEALLKAG-YTIARLAMLDMFPHTGHLE 424 Escherichia coli K-12
WP_003233892 418 GTLARDLRVLEDGG-YVTREVQPVDMFPHTNHVE 450 Bacillus subtilis
WP_029317479 424 STLAKDLQTLSKD--YRVDYIQPVDMFPQTAHVE 455 Bacillus subtilis
WP_010872035 420 PTLARDLKFLCAEGfYGITWVQGCDFFPQTAHVE 453 Synechocystis sp. PCC 6803
WP_001413792 392 ATLARDSEALLKAG-YTIARLAMLDMFPHTGHLE 424 Escherichia coli
P44643       398 ATLVRDAEILCNFG-YKIEKSAVIDMFPHTGHLE 430 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap