Conserved Protein Domain Family
tly

?
TIGR00478: tly 
TlyA family rRNA methyltransferase/putative hemolysin
Members of this family include TlyA from Mycobacterium tuberculosis, an rRNA methylase whose modifications are necessary to confer sensitivity to ribosome-targeting antibiotics capreomycin and viomycin. Homology supports identification as a methyltransferase. However, a parallel literature persists in calling some members hemolysins. Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture, often by forming a pore in the membrane. A recent study (2013) on SCO1782 from Streptomyces coelicolor shows hemolysin activity as earlier described for a homolog from the spirochete Serpula (Treponema) hyodysenteriae and one from Mycobacterium tuberculosis. [Unknown function, General]
Statistics
?
PSSM-Id: 129570
View PSSM: TIGR00478
Aligned: 5 rows
Threshold Bit Score: 234.699
Threshold Setting Gi: 499182133
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P19672         7 RLDVLLVERGLAETREKAKRAIMAGIVYSNENRLDKPGEKIDRDLPLTVKGNPLr-YVSRGGLKLEKALKEFPVSVKDKI 85  Bacillus subtil...
WP_010873034   8 RLDALLVAKGLCESRALAQRLIRAGEVKVNQQLVDKPGTLVTMDVAVELAQRPP--YVSRGGEKLAKALTEFAIDVTGRI 85  Synechocystis s...
WP_001235220   2 RLDYALFSQHLVNSREKAKALVLKNQVLVNKMVVSKPSFIVKENDKIELIAEKL--FVSRAGEKLGAFLETHFVDFKGKV 79  Helicobacter py...
WP_002656367   7 NLLNILCKRYPEKTRKELMILILKGNIYVNSHKEKNPKILINKTSKIDLVENTCqtFVSRGGYKLLEALKDFEIEVKNKI 86  Lyme disease sp...
WP_010879673   2 RLDILLVRRGFFSSRSRAKEAIKKGFVLVDGKKVTKPSAEVDFEAEIKVLQPER----PRGYWKLKEIDEHFNLFSGNEV 77  Archaeoglobus f...
P19672        86 MIDIGSSTGGFTDCALQNGAKQSYAVDVGYNQLAWKLRQDERVVVMERTNFR-YATPADFT-----KgmpEFATIDVSFI 159 Bacillus subtil...
WP_010873034  86 CLDGGISTGGFTDCLLQRGATKVYGVDVGYGQVAWKLRQDDRVILRERANFR-YLTPQDLYgdqpwP---DLGVMDLSFI 161 Synechocystis s...
WP_001235220  80 VLDVGASKGGFSQVALLKGAKRVLCVDVGKMQLDESLKQDKRIECYEECDIRgFKTPETI----------DLALCDVSFI 149 Helicobacter py...
WP_002656367  87 CVDVGSSTGGFTDCLLQCGANFVYSIDVGINQLSYKLRIDPRVKVLERTNIF-DVTEFKIV-----P---NFAVVDVSFR 157 Lyme disease sp...
WP_010879673  78 VLDLGSSAGGFLLYASEK-AKEVYGIEYSR-EFEEGLREIER----QRPNVK--VFIADAF------------TFDISL- 136 Archaeoglobus f...
P19672       160 SLRLILPVLRTLLV-PgSDCMALVKPQFEAGR---ESVGKKGIVRDPKVHADVLKRMISFSAAEGYICKGLSFSPITGGD 235 Bacillus subtil...
WP_010873034 162 SLTKVMAPLWSLLApP-REVVLLVKPQFEVGR---EKIGKKGVVRDAQAQAEAIDQVWRSGQSLGWQFNGLTFSPITGPA 237 Synechocystis s...
WP_001235220 150 SLYYILEAILPLSD----EFLTLFKPQFEVGRg--IKRNKKGVVVDKEAILNALENFKNHLKTKDFQILKIQESLVKGKN 223 Helicobacter py...
WP_002656367 158 SSISICVNLIDKLS-D-NFIIVLIKPQFEFKSlnlDIKNFNGVVSG-EYLKIILQSVIEKFYKNKLQVKKILKLKTKGKK 234 Lyme disease sp...
WP_010879673 137 -----LPELDLILN----DLTLPFSSSFRAMR------RFLPLLKK-GGIVLFVHKEGD-GESPDFGEMEVIGNLTSSDR 199 Archaeoglobus f...
P19672       236 GNIE 239 Bacillus subtilis subsp. subtilis str. 168
WP_010873034 238 GNVE 241 Synechocystis sp. PCC 6803
WP_001235220 224 GNVE 227 Helicobacter pylori
WP_002656367 235 GNQE 238 Lyme disease spirochete
WP_010879673 200 Kesy 203 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap