2DU3,2DU7


Conserved Protein Domain Family
sepS

?
TIGR00470: sepS 
Click on image for an interactive view with Cn3D
O-phosphoserine--tRNA ligase
This family of archaeal proteins resembles known phenylalanyl-tRNA synthetase alpha chains. Recently, it was shown to act in a proposed pathway of tRNA(Cys) indirect aminoacylation, resulting in Cys biosynthesis from O-phosphoserine, in certain archaea. It charges tRNA(Cys) with O-phosphoserine. The pscS gene product converts the phosphoserine to Cys. [Amino acid biosynthesis, Serine family, Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129562
View PSSM: TIGR00470
Aligned: 4 rows
Threshold Bit Score: 937.377
Threshold Setting Gi: 145579179
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DU3_A         1 MKFDPqkYRELAEKDFEAAWKAGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVK 80  Archaeoglobus f...
WP_010877111   1 MKRKD--IVKLSRRDFERAWLESGKSLRKPHHDMQYPRLRFETGKSHVLYDTIWMIREAYLRLGFSEMVNPLLIDEEHIY 78  Methanothermoba...
Q59054         1 MRFDIkkVLELAEKDFETAWRETRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIY 80  Methanocaldococ...
2DU7_A        11 MRFDIkkVLELAEKDFETAWRETRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIY 90  Methanocaldococ...
2DU3_A        81 KQFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSK--PLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDI 158 Archaeoglobus f...
WP_010877111  79 RQFGPEAPAVLDRCFYLGGLPRPDIGLGTGRIQMIEDMGIDVSDEKleNLKEVFRSYKKGDLSGDDLVLEVSNALEVESH 158 Methanothermoba...
Q59054        81 KQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKkeRLREVLHLYKKGAIDGDDLVFEIAKALNVSNE 160 Methanocaldococ...
2DU7_A        91 KQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKkeRLREVLHLYKKGAIDGDDLVFEIAKALNVSNE 170 Methanocaldococ...
2DU3_A       159 TAVKILDEVFPEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGEDATRLYTYFSASCVLVD 238 Archaeoglobus f...
WP_010877111 159 DGLRVLERVFPEIRDLKPVSGRTTLRSHMTSGWFISLQNIHDRYRMPLKLFSIDRCFRREQKEDSSHLMTYHSASCVVVD 238 Methanothermoba...
Q59054       161 MGLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVVVG 240 Methanocaldococ...
2DU7_A       171 MGLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVVVG 250 Methanocaldococ...
2DU3_A       239 EELSVDDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVgsstkysdGWIEIATFGIYSPTALAEYD 318 Archaeoglobus f...
WP_010877111 239 HEVPLDVGKAVAEGLLEHLGFSRFRFRPDEKKSKYYIPGTQTEVYAYHPLLK--------EWVEVATFGLYSPIALSMYG 310 Methanothermoba...
Q59054       241 EDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVYAYHPKLG--------EWIEVATFGVYSPIALAKYN 312 Methanocaldococ...
2DU7_A       251 EDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVYAYHPKLG--------EWIEVATFGVYSPIALAKYN 322 Methanocaldococ...
2DU3_A       319 IPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHgEIKLSDLDIAREIKVKEVPQTAVGLKIAQSIVETAEKHASEPSPC 398 Archaeoglobus f...
WP_010877111 311 IDQEVMNLGVGVERVAMILNQASDVREMVYPQIYgEWRLSDRDIAEMLRINLHPVTSDGRMLMEKIVKTWRAHADAPSPC 390 Methanothermoba...
Q59054       313 IDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFY-EYRLSDRDIAGMIRVDKVPILDEFYNFANELIDICIANKDKESPC 391 Methanocaldococ...
2DU7_A       323 IDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFY-EYRLSDRDIAGMIRVDKVPILDEFYNFANELIDICIANKDKESPC 401 Methanocaldococ...
2DU3_A       399 SFLAF-EGEMMGRN--VRVYVVEEEENTKLCGPAYANEVVVYKGDIYGIPKTK-----KWR----SFFEEGVPTGIRYID 466 Archaeoglobus f...
WP_010877111 391 SFEVY-SGEFLGRR--IEVSALEVEENTRLLGPAVWNTVYIHDGNILGVPPGTeldseLIT----RARKEGLNTGITYME 463 Methanothermoba...
Q59054       392 SVEVKrEFNFNGERrvIKVEIFENEPNKKLLGPSVLNEVYVYDGNIYGIPPTFegvkeQYIpilkKAKEEGVSTNIRYID 471 Methanocaldococ...
2DU7_A       402 SVEVKrEFNFNGERrvIKVEIFENEPNKKLLGPSVLNEVYVYDGNIYGIPPTFegvkeQYIpilkKAKEEGVSTNIRYID 481 Methanocaldococ...
2DU3_A       467 GFAYYAARKVEEAAMREQEEVKVKARIVENLSDINLYIHENVRRYILWKKGKIDVRGPLFVTVKAEIE 534 Archaeoglobus fulgidus
WP_010877111 464 ALAAEAAYRIEEMVVSGAEEVEVRSTIARSLSDLNLTLEDTAMRYITGKNREIDLRGPLFSTIRCRLR 531 Methanothermobacter thermau...
Q59054       472 GIIYKLVAKIEEALVSNVDEFKFRVPIVRSLSDINLKIDELALKQIMGENKVIDVRGPVFLNAKVEIK 539 Methanocaldococcus jannasch...
2DU7_A       482 GIIYKLVAKIEEALVSNVDEFKFRVPIVRSLSDINLKIDELALKQIMGENKVIDVRGPVFLNAKVEIK 549 Methanocaldococcus jannasch...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap