Conserved Protein Domain Family
pheS_mito

?
TIGR00469: pheS_mito 
phenylalanyl-tRNA synthetase, mitochondrial
Unlike all other known phenylalanyl-tRNA synthetases, the mitochondrial form demonstrated from yeast is monomeric. It is similar to but longer than the alpha subunit (PheS) of the alpha 2 beta 2 form found in Bacteria, Archaea, and eukaryotes, and shares the characteristic motifs of class II aminoacyl-tRNA ligases. This model models the experimental example from Saccharomyces cerevisiae (designated MSF1) and its orthologs from other eukaryotic species. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129561
View PSSM: TIGR00469
Aligned: 2 rows
Threshold Bit Score: 804.294
Threshold Setting Gi: 5656618
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08425    18 STLKVPHVEINGIKYKTDPQTtNVTDSIIKLTDRSLHLKESHPVGILRDLIEKKLNSVDN------TFKIFNNFKPVVTT 91  Saccharomyces cerev...
AAB65750  29 SPSSPPQLEVSGSTYATDGWT-NVTPKILSYVGANKHLQTDHPLSIIRQRIVNYFYGAYRnqrgnpLFSVYDQMNPVVTV 107 fruit fly
P08425    92 MENFDSLGFPKDHPGRSKSDTYYINETHLLRTHTSAHELECFQKIRNDsdniksgFLISADVYRRDEIDKTHYPVFHQME 171 Saccharomyces cerev...
AAB65750 108 QQNFDNLLIPADHVSRQKSDCYYINQQHLLRAHTTAHQVELISGGLDN-------FLVVGEVYRRDEIDSTHYPVFHQAD 180 fruit fly
P08425   172 gaTIWKRTKADVGVKEPMyIEKIREDIRQVENLLnkenvKITVDDDTIPLKENNPkqeyMSDLEVDLCSQHLKRSIELIV 251 Saccharomyces cerev...
AAB65750 181 --AVRLVTKDKLFERNPG-LELFEETWSGTLADP-----KLILPHPSSWTKPNSP----ATRRAVKLMEHEMKHVLVGLT 248 fruit fly
P08425   252 SEVFNKKIssmiknkanntpkelKVRWINAYFPWTAPSWEIEVWWQGEWLELCGCGLIRQDVLLRAGYKPSetIGWAFGL 331 Saccharomyces cerev...
AAB65750 249 KDLFGPRI---------------KYRWVDTYFPFTQPSWELEIYFKDNWLEVLGCGIMRHEILQRSGVHQS--IGYAFGV 311 fruit fly
P08425   332 GLDRIAMLLFEIPDIRLLWSRDERFSRQFSKG---LITSFKPYSKHPGSFRDVAFWLPEDKPDIHQVHENDLMEIIRNIA 408 Saccharomyces cerev...
AAB65750 312 GLERLAMVLFDIPDIRLFWSNDSGFLSQFSEKdlhNLPKYKPISHYPQCTNDLSFWLPQDIEVDAGFSPNDFYDLVRSVA 391 fruit fly
P08425   409 GDLVESVKLVDSFTHPKTGRKSMCYRINYQSMDRNLTNAEVNTLQDMVCSKLVKEYSVEL 468 Saccharomyces cerevisiae S288c
AAB65750 392 GDMVEQISLVDKFKHPKTGKSSVCFRIVYRHMERTLTQAEVNEIHKQIASASVDSFNVQI 451 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap