3K8D,1VIC


Conserved Protein Domain Family
kdsB

?
TIGR00466: kdsB 
Click on image for an interactive view with Cn3D
3-deoxy-D-manno-octulosonate cytidylyltransferase
[Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129558
View PSSM: TIGR00466
Aligned: 3 rows
Threshold Bit Score: 381.57
Threshold Setting Gi: 7387816
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3K8D_A  20 VVIIPARYASTRLPGKPLVDINGKPMIVHVLERAResGAERIIVATDHEDVARAVEAAGGEVCMTRADHQSGTERLAEVV 99  Escherichia coli
O25016   1 MIIIPARLKSSRFENKVLEDIFGLPMVVRCAKNAN--LVDECVVACDDESIMQTCQKFHIKAVLTSKHHNSGTERCLEAA 78  Helicobacter pylori 2...
1VIC_A   4 TVIIPARFASSRLPGKPLADIKGKPMIQHVFEKALqsGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVV 83  Haemophilus influenzae
3K8D_A 100 EKCAFSDDTVIVNVQGDEPMIPATIIRQVADnlAQRQVGMATLAVPIHNAEEAFNPNAVKVVLDAEGYALYFSRATIPWD 179 Escherichia coli
O25016  79 RILGLKNDERVLNLQGDEPFLEKEVILALLE--ATKNAPFMATCAKVIDEEQAKSPNLVKVVLDSQNNALYFSRSLIPFL 156 Helicobacter pylori 2...
1VIC_A  84 EKLAIPDNEIIVNIQGDEPLIPPVIVRQVADnlAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYD 163 Haemophilus influenzae
3K8D_A 180 RDRFAEGLETvg----dnFLRHLGIYGYR-AGFIRRYVNWQPSPLEHIEMLEQLRVLWYGEKIHVAVAQEVpGTGVDTPE 254 Escherichia coli
O25016 157 RDFDAKRQTP--------LLGHIGIYGFHnKEILEELCALKPCVLEEIEKLEQLRALYYQKKIAVKIVQSE-SVGIDTQE 227 Helicobacter pylori 2...
1VIC_A 164 RDQFMNLQDVqkvqlsdaYLRHIGIYAYR-AGFIKQYVQWAPTQLENLEKLEQLRVLYNGERIHVELAKEVpAVGVDTAE 242 Haemophilus influenzae
3K8D_A 255 DLE 257 Escherichia coli
O25016 228 DLQ 230 Helicobacter pylori 26695
1VIC_A 243 DLE 245 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap