Conserved Protein Domain Family
apsK

?
TIGR00455: apsK 
adenylyl-sulfate kinase
This protein, adenylylsulfate kinase, is often found as a fusion protein with sulfate adenylyltransferase. Important residue (active site in E.coli) is residue 100 of the seed alignment. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 129547
View PSSM: TIGR00455
Aligned: 6 rows
Threshold Bit Score: 272.034
Threshold Setting Gi: 7387595
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q02196         7 WHPN-LTYDERKALRKQDGCTIWLTGLSASGKSTIACALEQLLLQKNLSAYRLDGDNIRFGLNKDLGFSEKDRNENIRRI 85  Saccharomyces c...
O34577         8 WHEAsITKEEYQQKNKHKSSILWLTGLSGSGKSTIANAAARELFEQGYQVIVLDGDNIRHGLNRDLGFSDEDRKENIRRI 87  Bacillus subtil...
O06735         9 WHPAaISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRI 88  Bacillus subtil...
P72940         1 --------------MQQRGVTIWLTGLSGAGKTTITHALEKKLRDSGYRLEVLDGDVVRTNLTKGLGFSKEDRDTNIRRI 66  Synechocystis s...
O29953         1 -----------------MSFVIWITGPSGAGKTTLANALYKKLESMGYRVELLDGDGVRRKLYPNLGFSEEERWMHNRVV 63  Archaeoglobus f...
WP_001173674  10 WHSHpVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRV 89  Shigella
Q02196        86 SEVSKLFADSCAISITSFISPYRVDRDRARELHKEAglKFIEIFVDVPLEVAEQRDPKGLYKKAREGVIKEFTGISAPYE 165 Saccharomyces c...
O34577        88 GEVAKLFVQQGTIVITAFISPFREDRQQVRELVEAG--EFNEVYIKCDLDICEQRDPKGLYKKARNGEIPFFTGIDSPYE 165 Bacillus subtil...
O06735        89 GEVAKLFVDSGQMILTAFISPFREDRDMVRALFPKG--EFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYE 166 Bacillus subtil...
P72940        67 GFVSHLLTRNGVIVLVSAISPYAAIRQEVKHTIGDF----LEVFVNAPLAVCEERDVKGLYAKARSGEIKGFTGIDDPYE 142 Synechocystis s...
O29953        64 VEMARRLSRNGIITIVSVVSPYRAWREYARKEIEKF----VEVYPRCPLEVRMKRDPKGLYSKALRGEIKGLTGLDGEYE 139 Archaeoglobus f...
WP_001173674  90 GEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEG--RFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYE 167 Shigella
Q02196       166 APKAPELHLRTDQKTVEECATIIYEYL 192 Saccharomyces cerevisiae S288c
O34577       166 EPEAPELVLDSGQHDREACKNQLIEFV 192 Bacillus subtilis subsp. subtilis str. 168
O06735       167 APLSPDFIIESDQTSISDGADLIINAL 193 Bacillus subtilis subsp. subtilis str. 168
P72940       143 PPTNPDVECRTDLEELDESVGKIWQKL 169 Synechocystis sp. PCC 6803 substr. Kazusa
O29953       140 EPENPEVVVDTDKNDR----------- 155 Archaeoglobus fulgidus DSM 4304
WP_001173674 168 APESAEIHLN-GEQLVTNLVQQLLDLL 193 Shigella
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap