Conserved Protein Domain Family
tgt_general

?
TIGR00449: tgt_general 
tRNA-guanine family transglycosylase
Different tRNA-guanine transglycosylases catalyze different tRNA base modifications. Two guanine base substitutions by different enzymes described by the model are involved in generating queuosine at position 34 in bacterial tRNAs and archaeosine at position 15 in archaeal tRNAs. This model is designed for fragment searching, so the superfamily is used loosely. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129541
View PSSM: TIGR00449
Aligned: 9 rows
Threshold Bit Score: 454.941
Threshold Setting Gi: 3123066
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O51749   2 FSVIKNDKHfnARVGFLNLPHG----RVDIPCFMPVGTLGAMKGLKHAVLEKLE-CNLMLANTYHLYLRLGIKTVEKYVG 76  Borrelia burgdorferi B31
P19675   3 FELDTTDGR--ARRGRLVFDRG----VVETPCFMPVGTYGTVKGMTPEEVEATG-AQIILGNTFHLWLRPGQEIMKLHGD 75  Escherichia coli
P44594   3 YELDKTSGN--ARRGRLVFERPqgtfSVETPAFMPVGTYGTVKGMTPEEVRATG-AEILLGNTFHLWLRPGQEVMRKHGD 79  Haemophilus influenza...
O32053   8 YEFIKECKQtgARLGKVHTPHG----SFETPVFMPVGTLATVKTMSPEELKAMD-AGIILSNTYHLWLRPGQDIVKEAGG 82  Bacillus subtilis sub...
O28787   5 FRIKHTLDR--MRVGKVKTRHG----SFETPVFIPVATLAAIRGLDNRDLKDMG-VEVILANTYHLHLRPGDELIKELGG 77  Archaeoglobus fulgidu...
Q55983  10 YQCQARCSHsqARAGIFQTPHG----PVETPRFMPVGTLATVKGITPAQLADTQ-AQMVLANTYHLHLQPGEKIIAAAGG 84  Synechocystis sp. PCC...
O08314   3 FQLQATDNN--ARAGLLNLAHS----QVATPVFMPVGTQGCIKSLDATDAQEILgAKLILANTYHMYLRPGEKVVEELGG 76  Helicobacter pylori 2...
O29667   4 FEILDKDAM--GRICRIETPHG----RIETPTILPVINPNIPF-IRAEEMKKFG-AQAVITNSYIIYRS--MREEALEKG 73  Archaeoglobus fulgidu...
O26278   9 FEIKSKDGL--GRTGILKTEHG----TVRTPALMPVIHPGK----QTIDVKGPG-AEIVITNAYIIYRNPELRERALSDG 77  Methanothermobacter t...
O51749  77 LHNFTIWNKNFLTDSGGFRVFSFS----------------------DLRKIDLK----------GVHFKSHIDGSYHYFT 124 Borrelia burgdorferi B31
P19675  76 LHDFMQWKGPILTDSGGFQVFSLG----------------------DIRKITEQ----------GVHFRNPINGDPIFLD 123 Escherichia coli
P44594  80 LHDFMQWHRPILTDSGGFQVFSLG----------------------KLRKITEE----------GVKFQNPINGERIFLS 127 Haemophilus influenza...
O32053  83 LHKFMNWDRAILTDSGGFQVFSLS----------------------KFRNIEEE----------GVHFRNHLNGDKLFLS 130 Bacillus subtilis sub...
O28787  78 LHKFMNFDGVIVTDSGGFQAFSLGfgmehgvgkiannifleelreeRLREAENErkklavvtdrGVRFKDPKSGRIVELT 157 Archaeoglobus fulgidu...
Q55983  85 VHKFMGWSGPMLTDSGGFQVFSLS----------------------QLRTIGEQ----------GVLFRSPRDGRLIDMT 132 Synechocystis sp. PCC...
O08314  77 LHRFAQFYGSFLTDSGGFQAFSLS----------------------DNVKLQED----------GIVFKSHIDGSKHLFT 124 Helicobacter pylori 2...
O29667  74 VHGILETDMPVMTDSGSYQLMVYG-----------------------DVEIK---------------------------N 103 Archaeoglobus fulgidu...
O26278  78 VHRLIDFDGPIMTDSGSFQLSEYG-----------------------DIEVE---------------------------N 107 Methanothermobacter t...
O51749 125 SEGIFAMQEIFGSDIIMPLDICSSYGIDYNEANLYTNITTNWASSTFKSSKNRkegYNGLLFLITQGNFFKDLRKRSIND 204 Borrelia burgdorferi B31
P19675 124 PEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLg--NKNALFGIIQGSVYEDLRDISVKG 201 Escherichia coli
P44594 128 PEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELg--NKNALFGIIQGGVFEELRKVSLEG 205 Haemophilus influenza...
O32053 131 PEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLNAHNRQ---DEQGLFGIVQGGEYEDLRTQSAKD 207 Bacillus subtilis sub...
O28787 158 PKKSMEIQSNLGSDIIFAFDECTSPLSDRDYTEKALERTHRWAEECLQHYDRR-----QALFGVVQGGEYRDLREKSARF 232 Archaeoglobus fulgidu...
Q55983 133 PENSIRIQNALGADVIMAFDECPPGQGDRLMVEQATARTYRWLERCIEAHQRP---GDQALFGIVQGGTYLDLRSQAAEQ 209 Synechocystis sp. PCC...
O08314 125 PAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEYHKEKn-rPSNNLFAIIQGGTHLKMRSL-SVG 202 Helicobacter pylori 2...
O29667 104 AE-IVEFQRHIGSDIIVPLDIPTPPDADYATAESDLRITLEREREAKELLKGA----ENLLAVPVQGSTHPDLRRFAAGE 178 Archaeoglobus fulgidu...
O26278 108 PE-IIRFQDEIGTDIGTSLDIPTPPGVSHRRAIEEVEVTLERARESIEYRE------RMMLNAVVQGSTHPDLRRYCASR 180 Methanothermobacter t...
O51749 205 ILELDSPGIAIGGi-SVGEPR--EKYLEILEYSFLLIPKEKPRYVMGIGTPHYILNAIYYGIDIFDCFNPARITRHGSLL 281 Borrelia burgdorferi B31
P19675 202 LVDIGFDGYAVGGl-AVGEPK--ADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLF 278 Escherichia coli
P44594 206 LVNIGFDGYAVGGl-AVGEPK--EDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLF 282 Haemophilus influenza...
O32053 208 LISLDFPGYAIGGl-SVGEPK--DVMNRVLEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVF 284 Bacillus subtilis sub...
O28787 233 MAERDFAGYGIGG--SLGKSK--QDMLNILDWVIPLLPEEKPRHLLGIGAIEDLFNCTEKGVDMYDCVAPARWARRGHLY 308 Archaeoglobus fulgidu...
Q55983 210 LIALDLPGYAIGGv-SVGEAP--ALIDKVVQHTAPLLPAHKPRYLMGVGTYREMARAIFAGIDLFDCVIPTRFGRHGTAL 286 Synechocystis sp. PCC...
O08314 203 LTHEGFDGYAIGGl-AVGESA--DEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLF 279 Helicobacter pylori 2...
O29667 179 ARKIGGDIYPIGAvvPLMDAYrfRDLARVILEVRSALP-VEPIHLFGCGHPMLFAMAVALGCDLFDSAAYALYAKDDRYL 257 Archaeoglobus fulgidu...
O26278 181 LAELPVELHPIGAvvPLMESYryRELVDAVLSSVSELPPSRPRHLMGAGHPMLFALAVSMGCDLFDSAAYILYAEDDRLL 260 Methanothermobacter t...
O51749 282 TD--NG-------IMCIGRKEYKDDTSKVEKNCICTLCKRYSRGYLRHLIKSKELFGIVLASEHNIHYMFRLISKIRAAI 352 Borrelia burgdorferi B31
P19675 279 VT--DG-------VVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAI 349 Escherichia coli
P44594 283 VT--DG-------IVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAI 353 Haemophilus influenza...
O32053 285 TA--EG-------RLNMKNAKFERDFRPIDEECDCYTCKNYTRAYIRHLIRCNETFGLRLTTYHNLHFLLHLMEQVRQAI 355 Bacillus subtilis sub...
O28787 309 VSpaEGgnvrnkfRIHIKNAAFRIDNRPVDRTCDCLVCQNYSRAYLRHLYKANELLYFRLATYHNIYFVVKLMERIRESI 388 Archaeoglobus fulgidu...
Q55983 287 VQ--GE-------RWNLKNATFREDHRPLDETCPCYTCQTFSRAYLNHLIRSREMLGYILLSLHNITELIRFTQSIRQAI 357 Synechocystis sp. PCC...
O08314 280 TH--SG-------KISIKNAPYKLDNTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAI 350 Helicobacter pylori 2...
O29667 258 TV--YG-------TKKLSELN--------YFPCKCPVCSNHDPEELRRMEK-NERE--RLIAEHNLYVSFQEIETIKQAI 317 Archaeoglobus fulgidu...
O26278 261 ST--EG-------TYKLENLQ--------EMPCSCSVCTDYTPSELMGMDR-EERR--NLIAEHNLHVSFAEIRKVRQAI 320 Methanothermobacter t...
O51749 353 LNDDFLNFRTSYLKKYEEENF 373 Borrelia burgdorferi B31
P19675 350 EEGKLESFVTDFYQRQGREVP 370 Escherichia coli
P44594 354 EDDRFDDFVVEFYARMGKPVP 374 Haemophilus influenzae Rd KW20
O32053 356 REDRLGDFREEFFERYGYNKP 376 Bacillus subtilis subsp. subtilis str. 168
O28787 389 ADG---SFYELKREWLGF--- 403 Archaeoglobus fulgidus DSM 4304
Q55983 358 LND---TFTQDFAH---WLTP 372 Synechocystis sp. PCC 6803 substr. Kazusa
O08314 351 LEKRFLSFKKEFLEKYNSRSH 371 Helicobacter pylori 26695
O29667 318 KENSLFELVEKRVRAHPNMLA 338 Archaeoglobus fulgidus DSM 4304
O26278 321 HDGNLMELVEERCRAHPRLLE 341 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap