1GO3,2CKZ


Conserved Protein Domain Family
rpoE

?
TIGR00448: rpoE 
Click on image for an interactive view with Cn3D
DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form
This family seems to be confined to the archea and eukaryotic taxa and are quite dissimilar to E.coli rpoE. [Transcription, DNA-dependent RNA polymerase]
Statistics
?
PSSM-Id: 129540
View PSSM: TIGR00448
Aligned: 6 rows
Threshold Bit Score: 266.265
Threshold Setting Gi: 499181073
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GO3_E         1 MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPE 80  Methanocaldococ...
Q57840         1 MYKILEIADVVKVPPEEFGKDLKETVKKILMEKYEGRLDKDVGFVLSIVDVKDIGEGKVVHGDGSAYHPVVFETLVYIPE 80  Methanocaldococ...
WP_010878613   1 MYARIKLRDTVRVPPSKLGEDIEKVINSLLWEQFEGRLDREYGMIIGIESIEEIGEGRIIEGDGGVYFDVVFNAICFRPL 80  Archaeoglobus f...
WP_010875903   1 MYYVTKIVDTVRIPPDRFEEPLEEVAVEVLNETYVGRMDKNLGQLITVKEIEDIGIGKVIMGDGAAYHEVTFTALFFKPE 80  Methanothermoba...
P35718         1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF 80  Saccharomyces c...
2CKZ_B         1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPF 80  baker's yeast
1GO3_E        81 MYELIEGEVVDVVEFGSFVR-LGPLDGLIHVSQIMDDYVSYDPKREAIIG---KETGKVLEIGDYVRARIVAISLKAERK 156 Methanocaldococ...
Q57840        81 MYELIEGEVVDVVEFGSFVR-LGPLDGLIHVSQIMDDYVSYDPKREAIIG---KETGKVLEIGDYVRARIVAISLKAERK 156 Methanocaldococ...
WP_010878613  81 HQEVVEGEVIEIVEFGAFVS-IGPFDALLHMSQVTDDYMVFDEKNKRLVG---RETKKVLQEGDKVRARIVSLSLKEREP 156 Archaeoglobus f...
WP_010875903  81 LHEIVEGEVIEIAEFGAFVR-IGPVDGLVHVSQVTDDYITYDPKKGSLTG---KESGRRLDEGDLVRARIVALSLKGRR- 155 Methanothermoba...
P35718        81 LGEIVTGWISKCTAEGIKVSlLGIFDDIFIPQNMLFEGCYYTPEESAWIWpmdEETKLYFDVNEKIRFRIEREVFVDVKP 160 Saccharomyces c...
2CKZ_B        81 LGEIVTGWISKCTAEGIKVSlLGIFDDIFIPQNMLFEGCYYTPEESAWIWpmdEETKLYFDVNEKIRFRIEREVFVDVKP 160 baker's yeast
1GO3_E       157 -RGSKIALTMRQPYLGKLEWIEEE 179 Methanocaldococcus jannaschii DSM 2661
Q57840       157 -RGSKIALTMRQPYLGKLEWIEEE 179 Methanocaldococcus jannaschii DSM 2661
WP_010878613 157 -EKSKIGLTMRQPWLGALKWIEEE 179 Archaeoglobus fulgidus
WP_010875903 156 -EGVKVGLTMRQPGLGKFEWIEEE 178 Methanothermobacter thermautotrophicus
P35718       161 kSPKERELEERAQLENEIEGKNEE 184 Saccharomyces cerevisiae S288c
2CKZ_B       161 kSPKERELEERAQLENEIEGKNEE 184 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap